KEGG   Sulfuritalea hydrogenivorans: SUTH_00250Help
Entry
SUTH_00250        CDS       T03591                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00061  Fatty acid biosynthesis
shd00071  Fatty acid degradation
shd01100  Metabolic pathways
shd01212  Fatty acid metabolism
shd02024  Quorum sensing
Module
shd_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SUTH_00250
   00071 Fatty acid degradation
    SUTH_00250
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SUTH_00250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shd01004]
    SUTH_00250
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shd04147]
    SUTH_00250
Enzymes [BR:shd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     SUTH_00250
Lipid biosynthesis proteins [BR:shd01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   SUTH_00250
Exosome [BR:shd04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   SUTH_00250
  Exosomal proteins of breast cancer cells
   SUTH_00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: BAO28067
UniProt: W0SB01
Position
255876..257546
Genome map
AA seq 556 aa AA seqDB search
MNKPWLKHYPVGVPEEIDPTQYETVARVLEEAMQKYAARTAFICMGKSITYAQIDTASRG
LGAWLQSRGIAPGGRVAIMMPNIMQYPVAVAAILRAGYVVVNVNPLYTPRELEHQLKDSG
AEAIVIIENFATTLEKVIANTPVKHVVVAAMGDLLGGFKGTLVNFVVRRVKKMVPEFSLP
GSLRFNDAVAQGSGMTLKTVPRTRDDVAFLQYTGGTTGVSKGATLLNRNIVANMLQVEEW
MQPAINTHTDEQHNFVCALPLYHIFALTVCNMIGMRTGSCNLLIPNPRDIPGFVKELSTF
KFNVFPCLNTLFNALANNPEFAKLDFSTLKISLGGGMATQRPVAEKWMALTGSAIVEGYG
LSETSPVATCNVSTLKGFTGTIGLPVSSTEIAIRDDNGANVPLGESGEICIRGPQVMAGY
WQRPDETANVMTADGFFKSGDVGIMDETGATRIVDRKKDMVLVSGFNVYPSEIEEVAMKC
PGVMEAAVIGVPDEHSGEVPKIFIVKKDPALTEQVVQDFLKENLTGYKRPKYVEFRADLP
KTPVGKILRRELRPKS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccgtggctcaagcactatccggtcggcgtgccggaggaaatcgacccgacc
cagtacgagaccgtggcccgggtgctcgaagaggcgatgcagaaatacgccgcacgcacc
gcctttatctgcatgggcaagtcgatcacctacgcgcagatcgacaccgcctcgcgcggc
ctgggtgcctggctgcagtcgcgcggcatcgcccccggcgggcgcgtcgcgatcatgatg
cccaacatcatgcagtacccggtcgctgtcgccgcgatcctgcgtgccggctacgtggtg
gtgaacgtcaatccgctctatacgccgcgcgaactggagcaccagctcaaggacagcggc
gccgaggccatcgtcatcatcgagaacttcgccacgacgctggaaaaggtcattgccaac
acgcccgtcaagcacgtggtggtggcagcgatgggcgatctgctgggcggcttcaagggc
acgctggtcaatttcgtcgtgcgtcgcgtcaagaaaatggtgcccgagttctcgctgccg
ggttcgctgcgcttcaacgacgccgtggcccagggctccggcatgacgctgaaaaccgtg
ccgcgcacccgcgacgacgtcgctttcctgcaatacacgggaggcaccaccggcgtgtcg
aaaggcgccaccctgctcaaccgcaacatcgtcgccaacatgctgcaagtcgaggaatgg
atgcagccggcgatcaacacgcacaccgacgagcagcacaactttgtctgcgccctgccc
ctgtatcacatcttcgcgttgacggtctgcaacatgatcggcatgcgcaccggctcttgc
aacctgctgatccccaatccgcgcgacatccccggtttcgtcaaggaattgtcgaccttc
aagttcaatgtgtttccctgcctcaacacgctgttcaatgcgctggccaacaaccccgag
tttgccaagctcgacttctcgacgctgaagatcagtctcggcggcggcatggccacgcaa
cggccggtggccgagaagtggatggcgctgaccggcagcgcgattgtcgagggctacggg
ctctcggaaacctcgccggtggcgacctgcaacgtctccaccctcaagggatttaccggc
accattggtttgcccgtgtcatccaccgagatcgcgatccgcgacgacaatggcgccaat
gtcccgctgggcgagtctggcgaaatctgcatccgcggtccgcaggtgatggccggctac
tggcagcgccccgacgagacggcgaacgtgatgacggccgacggcttcttcaagtcgggc
gacgtcggcatcatggacgagaccggcgccacgcgcatcgtcgaccgcaagaaggacatg
gtgctggtctcgggcttcaacgtctatccgagcgagatcgaggaggtcgccatgaagtgc
cccggtgtcatggaggccgcggtgatcggtgtgcccgacgagcattcgggcgaggtgccg
aagatattcatcgtcaagaaggacccggcgctgaccgagcaggtcgtgcaggactttctc
aaggagaacctcactggctacaagcggccgaaatatgtcgaattccgcgccgatttgccg
aagacgccggtgggcaagatcctgaggcgcgagctgcggccgaagagctga

DBGET integrated database retrieval system