KEGG   Sulfuritalea hydrogenivorans: SUTH_01671Help
Entry
SUTH_01671        CDS       T03591                                 

Gene name
ppcY
Definition
(GenBank) UbiX-like carboxylase subunit,encoded in anaerobic phenol operon
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
shd00130  Ubiquinone and other terpenoid-quinone biosynthesis
shd00627  Aminobenzoate degradation
shd01100  Metabolic pathways
shd01110  Biosynthesis of secondary metabolites
shd01120  Microbial metabolism in diverse environments
shd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SUTH_01671 (ppcY)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SUTH_01671 (ppcY)
Enzymes [BR:shd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SUTH_01671 (ppcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: BAO29464
UniProt: W0SE17
Position
complement(1697044..1697655)
Genome map
AA seq 203 aa AA seqDB search
MKLVVGISGASGAIYGLRMLEVLKQAGVETHLVMSDSAKRTIVHETDYTIDAVRGLASQV
HDINDIGASIASGSFRHDGMVIAPCSIKTLSAVANSFTTNLLIRAADVTLKERRRLVLML
RETPLHLGHLRLMAQAVEIGAVMVPPMPAFYHRPQTLDDIINQSVGKALDQFNLDIGPDL
FKRWTGTEERQRARPQPGGDGNR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggtggtcggaatctcgggggcaagcggcgcgatctacgggctgcggatgctc
gaagtgctgaagcaggccggggtggaaacgcatctggtgatgtcggattccgccaagcgc
acgattgtccacgaaacggactacacgatcgatgcggtcaggggcctggccagccaggtg
cacgacatcaacgacatcggcgccagcatcgcttccggctcgttcaggcacgacggcatg
gtgatcgcgccctgctcgatcaagacgctctccgcggtggcgaattccttcaccaccaac
ctgctgatccgcgccgccgacgtaaccctgaaagaacggcgccggctggtgctgatgctg
cgcgagaccccgctgcacctcggccacctgcggttgatggcgcaggcggtcgaaatcggt
gccgtgatggtgccgccgatgccggctttctatcaccggccgcagaccctggacgacatc
atcaaccagtcggtcggcaaggcgctcgaccagttcaacctcgacatcggccccgatctg
ttcaagcgctggaccggcaccgaggagcgccagcgcgccaggccgcagccaggcggcgac
ggcaaccggtaa

DBGET integrated database retrieval system