KEGG   Shewanella sp. MR-4: Shewmr4_0561Help
Entry
Shewmr4_0561      CDS       T00388                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
she  Shewanella sp. MR-4
Pathway
she00670  One carbon pool by folate
she01100  Metabolic pathways
she01120  Microbial metabolism in diverse environments
she01200  Carbon metabolism
Module
she_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Shewmr4_0561
Enzymes [BR:she01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Shewmr4_0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ABI37641
UniProt: Q0HMS6
Position
643936..645648
Genome map
AA seq 570 aa AA seqDB search
MLTDMDISRRAPLKDIAVLGAEFGLLPDEMQLFGKTKAKVDLRVQQRLAEQQQGKLIIVT
AVTPTPHGEGKTVTTIGLTQSLKALGNKVCACIRQPSMGPVFGVKGGAAGGGYAQVVPMQ
ELNLHLTGDIHAVSNAHNLGAAAIASRLYHETRLGKAEFELQSGQNYLDIAPNGIRWHRV
VDHNDRCLREIEVGLGENNGPAYTSGFDITAASELMAILALSRNLADMRARIGKLVLAVN
RQGAAISAEDLGVAGAMTAIMADAVKPTLMQTLNGAPCLIHAGPFANIAHGNSSVIADDI
ALKLADFVVTEGGFGSDMGFEKFCNIKARQSGLTPSAAVLVTTLKALKANSGLTSDADIN
APDQARLEAGFANLNWHINNVARYGIPVVVAINRFATDTDAELNWLIEAVAGTAAFGCEL
SEAFSQGEAGALALAQTVMRACEQPSEFTLLYPDDMALEAKLSTLAEVGYGAAGVSLSEA
AKLQLQELSALGYADLPVCMAKTPLSISHDPQLKGVPQGFIVPVRELVLNAGAGFITALV
GNVMTMPGLGLVPGYLKIDIGADGEITGLG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccgatatggatatttcgcgccgtgcgcccctaaaagatatcgcagtgcttggc
gccgagtttgggttattgcccgatgagatgcagctatttggcaagacaaaagccaaggtc
gatttacgtgtgcagcagcgcttagcagagcagcaacagggtaagctgatcattgtcacc
gccgtgacaccaacgccccacggcgaaggcaaaaccgtcaccaccattggcttaacccaa
tccctcaaagcgcttggtaacaaggtgtgcgcctgtattcgccagcccagtatgggcccg
gtatttggggtgaaaggtggtgcagctggtggcggttacgcccaagtggtgcccatgcag
gagctgaatctgcatctaacgggtgatattcatgccgtcagcaatgcccataatcttggc
gcggcggcgatagcctctcggctatatcatgaaacacgtttaggtaaggccgaatttgag
ctgcagtctgggcagaattacctagatatagcgcctaatggcatccgttggcacagggtg
gtcgaccataacgatcgctgcttacgtgaaattgaagttgggctgggtgaaaataatggc
ccagcttacacctctggctttgatattaccgctgcctctgagttaatggcgattctggcg
ctcagtcgtaatctggcggatatgcgcgcgcgtattggcaagcttgtgctggcagtcaat
cgtcaaggtgcggctattagcgcggaagaccttggggttgccggcgcgatgacggcgatc
atggcggatgcggtaaaacccaccttgatgcagactttaaacggtgcgccttgtcttatt
cacgcagggccatttgcgaatattgcccatggcaactcgtcggtgattgccgacgatatc
gccttaaagctggccgattttgtggtgacggaaggcggttttggctccgatatggggttt
gagaaattttgtaatatcaaggcgcgccagtcgggattaaccccgagcgctgcggtgtta
gtgactaccttaaaggcattgaaggccaatagcggcttaacgtcggatgcggatatcaat
gcgcccgaccaagcccgtctcgaggcgggatttgccaacttaaactggcatatcaacaat
gtggcgcgttacggtattcccgttgtggtggctattaatcgctttgcaaccgatacggat
gccgagcttaactggttgattgaagccgttgcgggcactgccgcctttggctgcgagctt
agcgaggctttcagccaaggtgaggcgggggcattggccttggcgcaaaccgtcatgcgc
gcctgtgagcagccaagcgagtttaccctgctatatcccgatgacatggcgcttgaggcg
aaattatcgaccttagctgaagtcggctatggcgctgcaggggtgagtttatccgaggcg
gctaagctccaattacaagaactcagtgcccttggttacgccgatttacccgtctgcatg
gcaaaaacacccttatccattagccatgaccctcaacttaaaggcgtaccgcagggtttt
atcgtgccagtgcgcgagttagtgttaaatgctggagccggatttattaccgcgctggtg
gggaatgtgatgactatgccagggcttggattagttcctggctatttaaagattgatatc
ggcgcagatggcgagattactggcttaggttaa

DBGET integrated database retrieval system