KEGG   Shewanella sp. MR-4: Shewmr4_0581Help
Entry
Shewmr4_0581      CDS       T00388                                 

Definition
(GenBank) Thiopurine S-methyltransferase
  KO
K00569  thiopurine S-methyltransferase [EC:2.1.1.67]
Organism
she  Shewanella sp. MR-4
Brite
Enzymes [BR:she01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.67  thiopurine S-methyltransferase
     Shewmr4_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPMT
Motif
Other DBs
NCBI-ProteinID: ABI37661
UniProt: Q0HMQ6
Position
671412..672068
Genome map
AA seq 218 aa AA seqDB search
MEPGFWHEKWQQQLIGFHQQDINPFLVKYWQTLALPADAKVFVPLCGKSLDMCFLAEQGH
QVIGCELNELAVQQFFEENQLPMNQSAEGEHQHYQTEQVSLYQGDIFTLPQSITAQVNGF
YDRAALIAWPESMRTQYAKQLAQLLPSGSVGLLVTLDYPQETLSGPPFAVSPTWVETHLS
DDFEIQALACQDVLADNPRFVKKEVPWLNEAVYLLRRK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaacccggtttttggcatgagaagtggcagcaacagttgattggttttcaccagcaa
gatatcaatccctttctcgtaaagtattggcaaaccttggcattgcccgccgatgccaag
gtcttcgttcccctgtgtggcaagtctttagatatgtgctttttagccgagcagggccat
caagtgattggttgtgagttgaatgaactcgctgttcagcagtttttcgaagaaaaccaa
ttgcctatgaaccaaagtgcagagggcgagcatcagcattatcaaactgagcaggtcagt
ttatatcaaggggatatcttcactttacctcagtcaattacggcgcaggtgaatggtttt
tatgatcgtgccgccttaattgcttggcctgagagcatgcggacgcaatacgccaagcaa
ttagcgcagttattgccttcgggcagcgtaggcttgttagtcaccctagattacccacag
gaaaccttaagtgggccgccttttgcggtgtcgccaacttgggtcgaaacacatttaagt
gatgattttgaaatccaagctttagcttgccaagacgtgcttgcggacaatcctaggttt
gttaagaaagaagtcccatggctgaatgaagctgtgtatttattaagacgcaaataa

DBGET integrated database retrieval system