KEGG   Shewanella sp. MR-4: Shewmr4_0685Help
Entry
Shewmr4_0685      CDS       T00388                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
she  Shewanella sp. MR-4
Pathway
she00520  Amino sugar and nucleotide sugar metabolism
she00550  Peptidoglycan biosynthesis
she01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shewmr4_0685
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shewmr4_0685
Enzymes [BR:she01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Shewmr4_0685
Peptidoglycan biosynthesis and degradation proteins [BR:she01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Shewmr4_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABI37765
UniProt: Q0HMF2
Position
790585..791844
Genome map
AA seq 419 aa AA seqDB search
MDKLAIQASPPLAGDVIISGAKNAALPILMAGVLAETDFIVSNVPNLRDVSTSCKLLRCL
GADVDELGNGQIRISTKNLNEFCAPYDLVKTMRASILILGPLLARYGTADVSLPGGCAIG
ARPVNLHLHGLEMMGAKIEVKEGYIKARVDGRLKGAHIFMDMVSVGATENLLMAAALADG
ETVIENAAREPEVIDLANCLIAMGAKITGVGSATLRIQGVERLQGCEYRVMPDRIETGSF
LVAAAVTRGRIRCLKADPASLESVIAKLEDAGAKITTGEDWIELDMEGKRPKAVNIKTAP
YPGFPTDMQAQFCVLNVLAQGTATITETIFENRFMHVPELIRMGANMELEGNTCIIQGIE
SLSGAQVMATDLRASASLVIAGLVADGKTIVDRIYHLDRGYEHIEQKFQGLGAHVERVQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggataaattagcgattcaagcaagccctccgcttgctggtgatgtgattatttccggc
gctaaaaacgctgcgctgccgattctgatggcaggcgtgttagccgagactgattttatt
gtgtcgaatgtccccaatttgcgcgatgtgagcaccagctgtaaattgctgcgctgccta
ggcgccgatgtggatgagttaggcaatggtcaaatccgtatttcgaccaagaaccttaac
gagttctgcgcaccttacgatctcgttaagaccatgcgtgcctctattctgatccttggc
ccgttattagcccgttatggcacggcagatgtgtcattacccggtggctgcgccattggt
gctcgtccagtaaaccttcacttacatggcctcgaaatgatgggcgccaagattgaagtg
aaagaaggttatatcaaggcccgtgtcgatggtcgcttaaagggcgcccatatttttatg
gacatggtgagcgtgggcgcgactgaaaacctgttgatggccgcggcacttgccgatggc
gaaaccgtgattgaaaacgcggcccgtgaaccagaagtgatcgacttggctaactgtttg
attgccatgggcgcgaagatcactggtgtgggcagtgctacactgcgtattcaaggcgtt
gagcgtctacagggctgtgagtaccgtgtgatgccagaccgtatcgaaaccggttccttc
cttgttgccgcagcagtgacccgtggtcgtatccgttgcttaaaggccgatcctgcttca
ttagagtctgttatcgcaaaacttgaagatgcgggcgccaagatcaccactggtgaagat
tggattgagctcgatatggaaggcaagcgtccaaaagcggtaaatatcaagacggcgcca
tacccaggtttcccaaccgatatgcaggcgcagttctgcgtgcttaacgtattagcccag
ggcacggcaaccattaccgaaaccatcttcgaaaaccgctttatgcacgtgccagaactt
atccgtatgggcgcgaacatggagcttgaaggcaatacctgcattatccaaggcattgag
tctttgagtggtgcgcaggtgatggcgaccgatttacgtgcttcggcaagtctagtgatc
gcaggcttagtcgccgatggtaaaaccatagtcgatcgcatctatcacttagatcgcggt
tatgagcatatcgagcagaagttccaaggattgggcgcacatgtagaacgtgtgcaataa

DBGET integrated database retrieval system