KEGG   Shewanella sp. MR-4: Shewmr4_0907Help
Entry
Shewmr4_0907      CDS       T00388                                 

Definition
(GenBank) PpiC-type peptidyl-prolyl cis-trans isomerase
  KO
K03771  peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
she  Shewanella sp. MR-4
Brite
KEGG Orthology (KO) [BR:she00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:she03110]
    Shewmr4_0907
Enzymes [BR:she01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Shewmr4_0907
Chaperones and folding catalysts [BR:she03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    Shewmr4_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase Rotamase_3 SurA_N Rotamase_2 SurA_N_3 SurA_N_2 RHH_4 TraB TetR_C_5
Motif
Other DBs
NCBI-ProteinID: ABI37987
UniProt: Q0HLT0
Position
complement(1056711..1058015)
Genome map
AA seq 434 aa AA seqDB search
MKPSKHLIFALFALAISQPTMAAPQPIDRVAVQINDGIVLESEITNMIDTVKANARAANQ
SLPSDSALRTQVIERLILTRLQLQMADRIGLHIGDLQLDQAIENIAREQKMTVAQMQQKI
ESEGLSFGQYREQLREEITLGEIQRIQVQRRIQVSPQEITGLVKLIQEQGMKDVEYQIGH
ILIDVPNNPNSEQLEASSKRANAVLERLKSGEDFRRTAIASSSGPKALEGGIWDYMNINE
MPTLFAEVINGAKKGDIIGPIKSGAGFHIIKIMDARGLQTKEIEEVRARHILLKPSPILS
EDRAKAMLEQFLKQIRSGEAKFEDLARQYSEDPGSAAKGGELGWAEPSIYVPEFAQTLNS
LSQDQISEPFRTTHGWHITQLEERRKTDATDQFNTNRAHQLIFRRKFNEELQNWLDEMRA
DAYIEVFQPESNRG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccagtaaacatctgatttttgctttatttgcactcgctatcagccagcctact
atggccgctccccagccaatcgaccgtgttgccgttcaaatcaacgacggtattgtgctc
gaaagtgaaatcaccaacatgattgacactgtaaaagccaatgcgagagccgcgaatcaa
tcgttgccatccgacagtgcactgcgtactcaggttatcgagcgactgatcctcacccgt
ttgcagttgcagatggcggatcgtatcggtctgcatatcggtgacttacagttagaccaa
gcaattgaaaacattgcccgcgaacaaaaaatgaccgtggcgcaaatgcagcaaaaaatc
gagagcgaagggttaagcttcggccaataccgcgaacaactgcgtgaagaaatcaccctg
ggtgaaatccaacgtattcaagtacagcgccgtatccaagtgtcaccacaggaaatcact
ggcctggtaaaactgatccaagagcaaggcatgaaggacgtcgaataccaaatcggccat
atcctgattgacgtacctaacaatccaaacagtgaacaactggaagcctcgagcaagcgc
gcaaatgccgtactcgagcgtttaaagagtggtgaggatttccgccgcaccgccatcgcc
tcttcatcgggtcctaaggcgctggaaggcggtatctgggattacatgaacatcaacgag
atgccaacgctgtttgctgaagtcatcaacggtgcgaaaaaaggcgatattatcggccca
atcaagagtggcgccggtttccacattatcaagatcatggatgcccgtggcttacaaacc
aaagaaattgaagaagtcagagcgcgtcatatcctgctcaagccatcgccaattctgtcg
gaagatcgtgctaaggccatgttagagcagttcttaaagcaaattcgctctggcgaagct
aagtttgaagatttagcgcgtcaatattctgaagatccaggttcagcagccaaaggtggt
gagctaggctgggcagagccaagcatttatgtgccagagtttgcgcaaacccttaacagc
ttaagccaagaccaaatcagtgagcctttccgtacgacccacggctggcatatcacacag
ctggaagagcgcagaaaaaccgatgccacggatcaatttaatactaaccgtgctcaccaa
ctgatcttccgtcgcaaatttaatgaagaactgcaaaactggctagacgaaatgcgtgcc
gacgcatacattgaagtctttcagcctgagtcaaaccgaggttaa

DBGET integrated database retrieval system