KEGG   Shewanella sp. MR-4: Shewmr4_0974Help
Entry
Shewmr4_0974      CDS       T00388                                 

Definition
(GenBank) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
she  Shewanella sp. MR-4
Pathway
she00030  Pentose phosphate pathway
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
she01230  Biosynthesis of amino acids
Module
she_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
she_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shewmr4_0974
Enzymes [BR:she01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Shewmr4_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Av_adeno_fibre Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ABI38054
UniProt: Q0HLL3
Position
complement(1141167..1141826)
Genome map
AA seq 219 aa AA seqDB search
MTQDEMKKAAGWAALKYVEKDSIVGVGTGSTVNHFIDALATMKADIEGAVSSSEASTQKM
KALGIPVYDLNSVDKLSVYVDGADEINGHMDMIKGGGAALTREKIVAAVAEKFVCIVDNT
KQVDILGEFPLPVEVIPMARSYVARELVKLGGDPVYREGVVTDNGNVILDVYNLKIINPK
ELEEKINAIVGVVTNGLFAKRGADVLLVGTPEGVKTFTA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagatgaaatgaaaaaagccgctggctgggctgctctcaaatacgttgagaaa
gacagcattgtgggtgtaggcactggctcaaccgtcaatcactttatcgatgccctcgcc
accatgaaggccgatattgaaggtgcggtatcaagctcagaagcctcaacccaaaaaatg
aaagcccttggcatcccagtttatgacttaaacagcgtcgataaattatctgtgtatgtc
gatggtgccgatgaaatcaacggccatatggacatgatcaaaggcggcggcgcggcatta
acccgcgagaaaatcgttgcggctgtggctgaaaagtttgtctgtatcgtggataacact
aaacaagtggatattttgggtgaattcccactgcccgttgaagtgatcccaatggcgcgt
tcttacgtggcccgtgaactcgtcaaactcggcggcgacccagtgtaccgtgaaggcgtt
gtgactgataacggcaacgtaatcctcgacgtttacaaccttaagatcatcaatcctaag
gaattagaagagaagatcaacgccatcgtcggcgtagtgactaacggtttgttcgcgaaa
cgcggcgccgatgtgttactggttggcacccctgaaggcgtgaaaacctttaccgcttaa

DBGET integrated database retrieval system