KEGG   Shewanella sp. MR-4: Shewmr4_1491Help
Entry
Shewmr4_1491      CDS       T00388                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
she  Shewanella sp. MR-4
Pathway
she00430  Taurine and hypotaurine metabolism
she00620  Pyruvate metabolism
she00640  Propanoate metabolism
she00680  Methane metabolism
she01100  Metabolic pathways
she01120  Microbial metabolism in diverse environments
she01200  Carbon metabolism
Module
she_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewmr4_1491
   00640 Propanoate metabolism
    Shewmr4_1491
  09102 Energy metabolism
   00680 Methane metabolism
    Shewmr4_1491
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Shewmr4_1491
Enzymes [BR:she01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Shewmr4_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ABI38569
UniProt: Q0HK48
Position
complement(1746692..1747891)
Genome map
AA seq 399 aa AA seqDB search
MSNKLVLVLNCGSSSLKFAVIDAQTGDDQISGLAECFGLEDSRIKWKINGEKHESSLGAF
TAHREAVEFIVNKILAGQPELAAQIQAVGHRIVHGGEKFTRSVIIDEHVIKGIEECSSLA
PLHNPAHLIGIRAAIASFPKLPQVAVFDTAFHQSMPERAFIYALPYKLYREHGIRRYGMH
GTSHLFVSREAAKVLNKPLEETNVICAHLGNGASVTAVKGGKSVDTSMGLTPLEGLVMGT
RCGDLDPSIIYHLVHQLGYTLEEVNNLMNKQSGLLGISELTNDCRGIEEGYADGHKGATL
ALEIFCYRLAKYIASYTVPLGRLDAVVFTGGIGENSDIIREKVLNMLQIFNFHVDSERNK
AARFGKKGIITTDNSTVAMVIPTNEEWVIAEDSIKLITK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataaactggttttagtactcaattgcggtagctcttcactcaaatttgccgtc
attgacgcacaaacaggtgacgatcagatctctggcctagccgagtgttttggcttagaa
gactcgcgcattaaatggaaaatcaacggtgaaaagcatgagtcctctttaggtgcattt
actgctcaccgcgaagccgttgaatttatcgtcaataaaatccttgctggtcaacctgaa
ttagccgcgcaaattcaagccgtgggtcaccgtatcgtacacggcggtgagaaattcact
cgctctgtgatcatcgacgagcatgtgatcaaaggtattgaagaatgttcttcactggcg
ccactgcataacccagcacaccttatcggtattcgcgcggccattgcatctttccctaaa
ctgccacaagtggcggtgttcgatacggcattccaccaaagcatgcctgagcgcgctttt
atctacgctctgccatacaagctgtaccgtgagcatggtatccgccgctatggtatgcac
ggcactagccacctgtttgtcagccgtgaagccgctaaagtgttgaacaaacctttagaa
gagaccaatgtgatctgcgcgcacttaggtaacggtgcctctgtaacggcggttaaaggc
ggtaagagtgttgatacctcaatgggactgacgccgcttgaaggtttagtcatgggcact
cgctgtggcgatctcgacccatctatcatctaccacttagtgcaccaactcggttacact
ctggaagaagtcaacaacctgatgaacaagcaaagtggtctgctagggatttctgagcta
accaacgattgccgtggcatcgaagaaggttatgccgatggtcacaaaggcgcaacctta
gcactggaaatcttctgctaccgtctggcgaaatatatcgcgtcttacactgtgccactc
ggtcgtttagatgccgtggtctttaccggtggtatcggcgaaaactccgacatcatccgc
gagaaagtgctcaacatgctgcaaatcttcaatttccatgtagatagcgagcgtaacaaa
gcggcccgcttcggtaagaaaggcatcatcaccacagataacagcaccgttgccatggtc
atccccaccaacgaagagtgggttatcgccgaagattcgattaaactcattacaaaataa

DBGET integrated database retrieval system