KEGG   Shewanella sp. MR-4: Shewmr4_1632Help
Entry
Shewmr4_1632      CDS       T00388                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
she  Shewanella sp. MR-4
Pathway
she00020  Citrate cycle (TCA cycle)
she00190  Oxidative phosphorylation
she00650  Butanoate metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
Module
she_M00009  Citrate cycle (TCA cycle, Krebs cycle)
she_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
she_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewmr4_1632
   00650 Butanoate metabolism
    Shewmr4_1632
  Energy metabolism
   00190 Oxidative phosphorylation
    Shewmr4_1632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABI38708
Position
1933308..1933655
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDVWHGLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactttattctactacgc
gctagtgcagtaatcctcgcctgttacaccattttcatggttggctttattgcatgtagt
tcccctctcacctatgacgtttggcacggcctgtttagcgctctgccaatgaaagtgttt
accctgcttgcgctagttgcactgcttgttcacgcctggattggtgtatggcaagtattg
acggattacgtcaagtgcacttcgttacgcggtgttttacagttcaccttcgtcgtcacc
gtcttttgttatctggcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system