KEGG   Shewanella sp. MR-4: Shewmr4_1901Help
Entry
Shewmr4_1901      CDS       T00388                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
she  Shewanella sp. MR-4
Pathway
she03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:she00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shewmr4_1901
Enzymes [BR:she01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Shewmr4_1901
DNA repair and recombination proteins [BR:she03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Shewmr4_1901
    RecFOR pathway proteins
     Shewmr4_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH IMS_HHH 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ABI38975
UniProt: Q0HIZ2
Position
2265252..2265869
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGVLIEKQAPEVLIDVNGVGYELQMPLTSFYELPEVNQPTTVYTHFVVREDAQLL
YGFITKKERSLFRLLIKANGVGPKLALTILSGMTASEFVGCVERDDIVTLVKLPGVGKKT
AERLLVEMRDKLKSLMEASVGSEREFVLQSNYSPAPTVNSAEEDAISALLSLGYKPPQAS
KAVSAAYKEGMDSETLIKAALKSML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtttacgtggcgtgttaattgaaaagcaagcgccagaggtgttgattgat
gtcaatggcgtgggttacgagttacagatgccccttaccagcttctatgaactcccggag
gtcaatcaaccgaccacagtgtatacccattttgtggtgcgtgaagatgcccagctgctt
tacggctttatcactaaaaaagagcgctcactgtttcgcttgcttatcaaggccaacggc
gtgggtcctaaactggcgttaaccattctttctggcatgaccgccagcgagtttgtgggc
tgtgtcgagcgcgatgatatagtgacgctggtgaaattacccggtgttggtaaaaagacc
gccgaacgtttattagtcgagatgcgcgataaattgaagagcttgatggaagcatcggta
ggctctgagcgtgagttcgtgctgcaatctaactattcaccggctccgacggtcaatagt
gccgaagaggatgcgatttcagccttgctctccctcggctataaaccaccacaggcgagt
aaagccgtttctgccgcctataaagaaggcatggacagtgagaccttgattaaggccgcg
ttaaaatcgatgctctaa

DBGET integrated database retrieval system