KEGG   Shewanella sp. MR-4: Shewmr4_1985Help
Entry
Shewmr4_1985      CDS       T00388                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
she  Shewanella sp. MR-4
Pathway
she00010  Glycolysis / Gluconeogenesis
she00052  Galactose metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr4_1985
   00052 Galactose metabolism
    Shewmr4_1985
Enzymes [BR:she01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Shewmr4_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABI39058
Position
2360643..2361698
Genome map
AA seq 351 aa AA seqDB search
MQLSVTKKSLQHAAFADELQLVTLTNSHGLEVVLSNYGASIWSVKFYGQAQEPISLSLGY
QDIKDWATNPYYFGITAGRVANRIGKAQFPLAGKTIQLVANEGNNQLHGGPKGLSHCTWQ
VETLQDNDSVAAVFSITSPDGDQGFPGNLAIKLEYRLNENNELTLNYQAVCDQTTPVCLT
NHAYWNLASNKQQGILGHELSIQASHFLALDNEQIPTGELTLVDDGAYDFKQPKLIATDI
KQLTNGYDHYFVMDRNPDNKNSLQTIAVLKDPLSGRELEISTTEVGVQFYSGNFLDGSHI
DDEGYSINQFHGLCLETHGYPNAVNIAHFPSVMLEANTQYQQITVHKFKNI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaactctctgttactaaaaaaagcctacaacacgccgcatttgcggatgaattacaa
ttagtcacgctcaccaatagccacgggcttgaagtggttctgtcaaattacggcgccagc
atttggtcggtcaaattttatggtcaagcgcaagaacctatttcattaagtcttggctat
caagatattaaagattgggcgactaatccgtattattttggtattaccgcaggccgtgtc
gcaaatcgtattggtaaagcacaattccccttagcaggtaaaacaattcaattagtcgcc
aatgaaggcaataatcaacttcacggcggacctaaaggattaagccattgcacttggcag
gttgagacgctgcaggacaatgacagtgtggcggcggttttcagcattaccagccccgat
ggcgatcaaggatttccgggtaatcttgccattaagctagaataccgcctcaatgaaaac
aatgaattaactctgaattatcaagccgtttgcgatcaaaccacccccgtctgtttaacc
aatcatgcttactggaatcttgcctccaacaaacagcagggcattttagggcacgaactc
tccattcaagccagccatttcctggcactcgataatgaacagatcccaacaggcgaatta
accttagtcgacgatggcgcttacgatttcaaacaaccgaagctaattgccacggatatt
aagcaattaactaatggttatgatcattattttgttatggatagaaatcctgacaataaa
aacagtttgcagactattgcggtgttaaaagatcctctttctggccgagaactcgaaatt
agtaccactgaagtcggcgtgcaattttatagcggtaactttctcgatggcagccatatt
gatgatgaagggtatagcattaatcaattccatggcctgtgtttagaaacccacggttat
ccgaatgcggtaaacattgcccatttcccgagtgtcatgcttgaggcaaatactcaatat
caacaaattacggtacataagtttaagaatatttaa

DBGET integrated database retrieval system