KEGG   Shewanella sp. MR-4: Shewmr4_2597Help
Entry
Shewmr4_2597      CDS       T00388                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
she  Shewanella sp. MR-4
Pathway
she00071  Fatty acid degradation
she00072  Synthesis and degradation of ketone bodies
she00280  Valine, leucine and isoleucine degradation
she00310  Lysine degradation
she00362  Benzoate degradation
she00380  Tryptophan metabolism
she00620  Pyruvate metabolism
she00630  Glyoxylate and dicarboxylate metabolism
she00640  Propanoate metabolism
she00650  Butanoate metabolism
she00900  Terpenoid backbone biosynthesis
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
she01212  Fatty acid metabolism
she02020  Two-component system
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewmr4_2597
   00630 Glyoxylate and dicarboxylate metabolism
    Shewmr4_2597
   00640 Propanoate metabolism
    Shewmr4_2597
   00650 Butanoate metabolism
    Shewmr4_2597
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shewmr4_2597
   00072 Synthesis and degradation of ketone bodies
    Shewmr4_2597
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewmr4_2597
   00310 Lysine degradation
    Shewmr4_2597
   00380 Tryptophan metabolism
    Shewmr4_2597
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewmr4_2597
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shewmr4_2597
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shewmr4_2597
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:she04147]
    Shewmr4_2597
Enzymes [BR:she01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shewmr4_2597
Exosome [BR:she04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr4_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PDT
Motif
Other DBs
NCBI-ProteinID: ABI39668
Position
complement(3093010..3094200)
Genome map
AA seq 396 aa AA seqDB search
MSTEQFNQEIVIVAAKRTPMGGFQGSLSGVTSPSLAATAIKALLTDTQVAPDKVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLLKAGSAKLVVAGG
MESMSQAPYLLDKARSGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEYGLTREQ
MDAFALSSLEKANAAINSGAFKAEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
AKDGTITAANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLSNVGWSKDEVDLFEINEAFAMVTMLAVSELGLDMAKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacaatttaaccaagagatcgttattgttgccgctaaacgcaccccaatg
ggtggctttcaaggcagtttgtctggtgtaacgtctccgagcttagcggccaccgccatc
aaagccctgctcactgatacccaagttgcgcctgacaaggtcgatgaagtgttaatgggc
tgcgtattgccagcgggtctgggtcaagcgccagcgcgtcaggcgactttaggtgcaggt
ttacctctgtctgtgggtgcaaccacagtgaacaaagtctgtggctctgggatgaaaacc
gtgatgctcgcccatgatttattgaaggcgggcagtgctaagttggtggttgctggcggt
atggaaagcatgagccaagccccttacttgctagataaagcgcgctcaggcatgcgtatg
ggccatggcaaggtattagatcatatgttcctcgatggtttagaagatgcctacaccggc
ggcgccatgggcacattcgcccagaaaaccgccgatgaatacggcctaacccgcgagcaa
atggatgcctttgccttaagctcactggaaaaagccaacgcggccattaactctggtgcc
ttcaaggcggagattgtgcctgtcacggtaagcgatcgccgtggtgatgtgactatcgat
accgatgagcagccaggtaatgcccgtcctgaaaaaatcccaaccctgcgtccagctttt
gctaaagacggcactattactgcggcaaactcaagctcaatttcagatggtgcggcggcg
ctaatgctaaccacccgcgcgaatgccgagcagttaggcttaactgtgctcgccactatc
aagggccacactacccatgcccaggagccatcactctttaccacggcgcccgttggcgct
atggcaaaactgctgagcaatgtgggctggtcaaaggatgaagttgatctgttcgaaatc
aacgaagcctttgccatggtgactatgctagccgtttctgaattaggtttagacatggca
aaagtgaacgtgaacggtggcgcctgcgccttaggtcatcctatcggttgctcgggcgca
cgtttactggtgaccttaatccatgcacttaaagcccgtgggcttaagcgtggcgtagcc
tcactttgtatcggtggtggtgaagcgactgctatggctatcgaagtttaa

DBGET integrated database retrieval system