KEGG   Shewanella sp. MR-4: Shewmr4_2607Help
Entry
Shewmr4_2607      CDS       T00388                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
she  Shewanella sp. MR-4
Pathway
she00360  Phenylalanine metabolism
she00400  Phenylalanine, tyrosine and tryptophan biosynthesis
she00790  Folate biosynthesis
she01100  Metabolic pathways
she01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Shewmr4_2607
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shewmr4_2607
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewmr4_2607
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Shewmr4_2607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ABI39678
Position
complement(3103320..3104135)
Genome map
AA seq 271 aa AA seqDB search
MTKEIAHTAPYVARSADDSGYIHYPQEEHEIWSQLYARQAVNLPGRACKEYLQGLDALAM
PKDRIPQLAEIDKVLQATTGWKTAAVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQ
EPDIFHEIFGHCPLLTNPSFAHFSHIYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQDG
ELCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDMLDE
IAKMDIMAYVAKARQLGLFSPKYPPKTKKAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagagatagcgcacaccgctccctacgttgcgagaagtgcagatgattcaggg
tatatccattacccgcaggaagaacatgagatttggagccaattgtatgctcgccaagcg
gtaaacctaccggggcgtgcctgtaaggaatatcttcaaggactcgatgccttggctatg
cccaaggatcgcattccacaattggcagagatagacaaagtattgcaggccactactgga
tggaaaaccgcggccgtaccagctttgatttcctttggccgcttctttgagctattggca
aataaggaatttccagttgcgacctttatccgccgcaaggaagagtttgattacctgcaa
gagccggatattttccatgagatctttggccattgccccttgctgaccaatccttctttc
gcccatttctcccatatctatggtcaattgggcttaaatgccagcaaggaagaccgcgtc
tttttagcgcgcctgtattggtttaccgtcgagtttggcctactcaaacctcaagatggc
gaattgtgtatctacggcggcggtattttaagctctcccggcgaaaccttgtatgccatg
gaaagccaagtgcctgagcgtaagcccttcgatctcttagatgtgctgcgcacgccttat
cgtatcgatattatgcagccgatttattatgtgattgaacatattgatatgttggatgaa
attgccaagatggacatcatggcctatgtggctaaggcgcgtcagttgggcttgttttcc
cctaaatatccgcccaagaccaagaaagccagctaa

DBGET integrated database retrieval system