KEGG   Shewanella sp. MR-4: Shewmr4_3911Help
Entry
Shewmr4_3911      CDS       T00388                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
she  Shewanella sp. MR-4
Pathway
she00860  Porphyrin and chlorophyll metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
Module
she_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:she00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shewmr4_3911
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Shewmr4_3911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ABI40974
Position
4663820..4665160
Genome map
AA seq 446 aa AA seqDB search
MIEKYNYSGPRYTSYPTALEFDDSFTEQNLLTAIESSKSDKLSLYIHIPFCAKLCYYCGC
NKVITRHAHKADQYIEYLSHEIIKRAPLFKHYTVTQMHWGGGTPTFLNPEQILKLTDLIK
ANFNFAAEGEFSIEVDPREIELSMLDTLKEAGFNRISIGVQDFNKEVQVAVNREQDEQFI
FDLMAKAKAMGFVSTNIDLIYGLPHQTPETFAATMQRVLDLSPDRLSVFNYAHLPARFAA
QRKIKDEHLPSPKQKLEMLHQTIETLTGAGYQYIGMDHFAKPDDELAKLQREGKLHRNFQ
GYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRPYYEAIDKDGHALWKGCSLNRDDEIRR
VVIKQLICHFDLDMAKMDEKLGIKFEEYFAEDLKLLQTFIDDKLVDVTDRKITISPTGRL
LIRNICMCFDLYYRQKARQQQFSRVI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaaaatataactacagcggtccccgttacacttcttacccaacggcgctggag
ttcgatgattcattcactgaacaaaacctgttaacggcgattgaaagcagtaagagcgac
aaactgtcgctgtacattcacatccccttctgcgccaaactttgctactactgtggctgt
aataaagttatcactcgccacgcccacaaggccgatcaatatatcgagtatttaagccac
gaaattattaagcgcgctccactgtttaagcactacacagtcacccaaatgcactggggc
ggcggcactccaaccttcttaaatcccgagcaaattctgaagttaaccgacttaatcaag
gctaattttaactttgccgctgaaggtgagttctctatcgaagttgacccgcgtgagatt
gagctttcaatgctagataccttgaaagaagcgggctttaaccgcatttctatcggggtg
caagacttcaataaagaagtacaagtcgcggttaaccgtgagcaggacgagcaatttatt
ttcgatttaatggccaaagccaaggccatgggatttgtctcaaccaatatcgacttaatt
tacggtctgccacatcagacacccgaaacattcgccgccaccatgcagcgcgtgttagac
ctgtcgcccgatcgtctatccgtgttcaactatgctcatttacccgcgcgttttgccgcg
cagcgtaagattaaagatgaacatttaccttcgccaaaacaaaaactcgagatgttgcat
caaacgatcgaaactttaactggcgcgggttatcagtacatcggcatggaccacttcgcg
aagcccgacgatgagctggctaagttgcaacgcgaaggtaaattgcatcgcaacttccag
ggttataccacccaagaagaatgcgacctgctcggtctgggcgtgtcttcaatcagccaa
atcggcgattgttatgcgcaaaatcagaaggacattcgtccttactacgaagccatcgac
aaagacggccacgcgctgtggaaaggctgtagtctgaaccgtgacgacgaaatccgccgt
gtcgtgatcaaacaactgatctgccacttcgatttagatatggcaaaaatggacgaaaaa
ctgggtattaagtttgaggaatacttcgccgaagacttaaaactgctgcaaacctttatc
gatgataagttagtcgacgtcaccgacagaaagatcaccatcagccccactggccgtctg
ttgatccgcaatatctgtatgtgcttcgacctttactaccgtcaaaaagcgcgtcaacaa
cagttctcccgtgtgatctaa

DBGET integrated database retrieval system