KEGG   Shewanella sp. MR-4: Shewmr4_3936
Entry
Shewmr4_3936      CDS       T00388                                 

Definition
(GenBank) glucose inhibited division protein A
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
she  Shewanella sp. MR-4
Brite
KEGG Orthology (KO) [BR:she00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:she03016]
    Shewmr4_3936
   03036 Chromosome and associated proteins [BR:she03036]
    Shewmr4_3936
Transfer RNA biogenesis [BR:she03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Shewmr4_3936
 Prokaryotic type
    Shewmr4_3936
Chromosome and associated proteins [BR:she03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Shewmr4_3936
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored FAD_binding_2 Pyr_redox_2 DAO Thi4 HI0933_like AlaDh_PNT_C Pyr_redox MarR_2 Pyr_redox_3 ACP_syn_III_C
Other DBs
NCBI-ProteinID: ABI40999
UniProt: Q0HD68
Position
complement(4697488..4699377)
AA seq 629 aa
MHFHERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMSCNPAIGGIGKGHLV
KEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQPNLRI
FQQAVDDLVVENDRVVGVITQMGLAFEAPAVVLTAGTFLSGKIHIGLENYSGGRAGDPPS
IALAHRLRELPIRVGRLKTGTPPRIDANTIDFTQMTEQKGDTPLPVMSFMGDVSHHPKQI
SCWITHTNEKTHDIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFSDKSSHQIFIEPE
GLNTNEIYPNGISTSLPFDVQLNLVRSIQGMENAEIVRPGYAIEYDYFDPRDLKNSLETK
TINGLFFAGQINGTTGYEEAGAQGLLAGMNAALQVQGKEAWCPRRDEAYIGVLVDDLSTL
GTKEPYRMFTSRAEYRLLLREDNADLRLTAKGRELGLVDDARWASFSEKLESIELELQRL
RSQWIHPNSPLVPVLNPHLNTPISREASFEELLRRPEMDYSKLMQIEGFGPGLADPLAAE
QVQIQVKYSGYIQRQQEEINKAVRNENTGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQ
ASRISGITPAAISILLVHLKKRGLLRKSA
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcattttcatgaacggtttgatgttattgttgtaggtggtggtcatgccggaactgaa
gccgcattggctgcagcaagaatgggctctaaaacattattgctgacgcacaatcttgat
actctaggacaaatgtcatgcaacccagcaatcggtggtattggcaaaggtcatttggta
aaagaaatcgatgcattaggcggtgcaatggcgatcgcaaccgactacgcagggatccaa
tttagaaccctaaactcgagtaaaggtccagcggtaagagcgactcgtgctcaggccgat
cgcgctctgtaccgtcagaagatccaaaatattctgcaaaaccaacccaacttacgcatt
tttcaacaggcagttgatgatctagttgttgagaatgaccgcgttgtaggtgtgattacc
caaatgggcttagccttcgaagctccagccgtggtattaaccgcggggactttcctcagt
ggtaaaatccatattggtttagaaaattacagtggcggtcgtgctggcgatccaccatca
atcgcactcgcccatcgcttacgcgagttgccaatccgtgttggccgtttaaaaacgggt
acaccaccccgtatcgacgccaataccattgattttacccaaatgacagagcagaaaggc
gatacgccattacctgtgatgtcatttatgggtgatgtgagtcatcacccgaaacaaatt
tcatgttggattacacacaccaatgaaaagactcacgatattattcgtggtggcttagat
cgcagccctatgtattcaggcgtgatcgaggggattggtccacgttactgcccttctatc
gaagacaagatccatcgtttttcagataaatcatcacaccagatctttatcgaacccgaa
ggattaaatactaacgagatctaccctaacggcatctccaccagcttgcccttcgatgtg
cagttaaatctggttcgttcgatccaaggcatggaaaatgctgagattgttcgccctggt
tatgctattgagtacgattattttgatccaagggatcttaaaaattcgttagaaaccaaa
acgatcaatggtttgttcttcgcgggccaaatcaacggtactacggggtatgaagaagcc
ggtgctcaaggtttactcgctgggatgaacgctgcgctgcaggttcaaggcaaagaagct
tggtgccctcgccgtgatgaagcttatatcggcgtattggttgacgatttatcaacctta
ggcaccaaagagccctaccgtatgtttaccagccgcgccgaataccgcctactgctgcgt
gaagacaacgccgatctgcgcttaacggcaaaaggtcgtgaactgggtctggtggatgat
gcgcgttgggcctctttcagtgaaaaactggaatcgatcgagttagaactgcaacgtcta
cgtagccaatggatccatccaaattcacctttagtgccagtgttaaatccgcatttaaac
acgccgatctcccgtgaagcgtcgtttgaagagttgctgcgtcgtccagaaatggattac
agcaagctgatgcagattgaaggctttggtccaggtcttgccgatccactcgctgccgag
caagtacagatccaggtgaagtactctggctatatccaacgtcagcaggaagagatcaac
aaagcggttcgtaatgagaacacaggtttgccattgaaccttgattacaaagaggttcct
gggctttcaaacgaggttattgctaagttaaatagccataagcccgaaaccattggccaa
gcatcgcgtatctcaggtattactccggcagcgatttcaattctgctagtgcatctgaaa
aaacgcggtttattacgcaagagtgcgtaa

DBGET integrated database retrieval system