KEGG   Shewanella sp. WE21: CKQ84_00555Help
Entry
CKQ84_00555       CDS       T05404                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
shew  Shewanella sp. WE21
Brite
KEGG Orthology (KO) [BR:shew00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:shew03016]
    CKQ84_00555
Enzymes [BR:shew01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CKQ84_00555
Transfer RNA biogenesis [BR:shew03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CKQ84_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AVI64490
UniProt: A0A2R3EQ02
Position
complement(128348..129193)
Genome map
AA seq 281 aa AA seqDB search
MNQDDIWLETPENAVNVSQEDDSEEQAPEIEILYEDEHLVAIHKPAGLLVHRSYLARRER
FFAMQLTRDLVGCHVFPVHRLDRPTSGVLLFAKSSEVANALCEQFASHTVEKQYLALVRG
NMHESGILDYALKVELDELGDKNADPNKAAQEAVTAYEPLLNTEIPYQSGRYPTSRFALV
RLSPKTGRKHQLRRHMAHLRHPIVGDTTHGDGKQNAFFREHFGINRLWLIAKKLTFTHPI
TQTRLSIETELESEWETVFAELGWDEATLSQQAELFIAQEA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagatgatatctggcttgaaacgcctgaaaatgcagtgaatgtatcccaagag
gatgattcagaagagcaggcgcctgagattgaaattctttatgaagatgagcacttagtg
gcaattcataaacccgcaggcttattggtccaccgcagttatttagcgcgtcgggagcga
ttttttgccatgcagctgacacgtgacttagtgggctgtcatgtgtttcctgtacatcgt
ctcgacaggccgacatccggcgtgctcttgtttgccaagagtagtgaagtggctaatgct
ctgtgtgagcaatttgcctcccatacggttgaaaaacaatatctggctttagtgcgcggt
aatatgcatgagagcggtattttagactatgcgcttaaggttgagttggatgaattaggc
gataagaatgccgatcctaataaagcggcgcaggaggctgtgacggcgtatgagccgtta
ctcaatactgaaattccgtatcagtcaggccgatatcccactagccgattcgcactggta
cgcttgagtcctaaaacggggcgtaagcatcagcttagaaggcatatggcacatttacgc
caccccatcgtcggtgataccacccatggcgacggtaagcaaaatgcgttttttcgtgag
catttcggtattaatcgcctgtggcttatcgcaaaaaaactcacctttacacacccaata
actcaaactcggctcagcatagaaaccgagctcgagtctgagtgggaaactgtgtttgcc
gagttaggttgggacgaggcgaccttgagtcaacaagctgagttattcatcgcccaagag
gcgtga

DBGET integrated database retrieval system