KEGG   Shewanella sp. WE21: CKQ84_20775Help
Entry
CKQ84_20775       CDS       T05404                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
shew  Shewanella sp. WE21
Pathway
shew00230  Purine metabolism
shew00240  Pyrimidine metabolism
shew01100  Metabolic pathways
shew01110  Biosynthesis of secondary metabolites
shew01130  Biosynthesis of antibiotics
Module
shew_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
shew_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
shew_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
shew_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:shew00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CKQ84_20775
   00240 Pyrimidine metabolism
    CKQ84_20775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shew04131]
    CKQ84_20775
Enzymes [BR:shew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CKQ84_20775
Membrane trafficking [BR:shew04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CKQ84_20775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AVI68068
UniProt: A0A2R3EZF9
Position
complement(4657780..4658211)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVASKMLHLTKEQAEGFYAEHSERGFF
GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAESIDENAAHGSD
AVESAAREIAYFFSAEELCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcacattttctattatcaagccagatgctgttgcaaaaaaccacatc
ggtgctatctacaatcgttttgaaactgctggtcttaagatcgttgcatcaaaaatgtta
cacctgaccaaagaacaagctgaaggtttctatgctgagcatagcgagcgcggcttcttc
ggtgctctggttgcattcatgacttctggtcctatcatggtccaagtattagaaggcgaa
aacgctgttttagctcaccgtgaaattttaggtgcaactaacccagctcaagcagctcct
ggtactatccgtgctgatttcgcagaaagcattgacgaaaacgcggctcacggttcagat
gctgttgaatctgctgctcgtgaaattgcttacttcttcagcgctgaagaattgtgtcca
cgcactcgttaa

DBGET integrated database retrieval system