KEGG   Shewanella sp. FDAARGOS_354: CEQ32_07820Help
Entry
CEQ32_07820       CDS       T04944                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shf  Shewanella sp. FDAARGOS_354
Pathway
shf00280  Valine, leucine and isoleucine degradation
shf00310  Lysine degradation
shf00362  Benzoate degradation
shf00380  Tryptophan metabolism
shf00620  Pyruvate metabolism
shf00630  Glyoxylate and dicarboxylate metabolism
shf00640  Propanoate metabolism
shf00650  Butanoate metabolism
shf00900  Terpenoid backbone biosynthesis
shf01100  Metabolic pathways
shf01110  Biosynthesis of secondary metabolites
shf01120  Microbial metabolism in diverse environments
shf01130  Biosynthesis of antibiotics
shf01200  Carbon metabolism
shf01212  Fatty acid metabolism
shf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEQ32_07820
   00630 Glyoxylate and dicarboxylate metabolism
    CEQ32_07820
   00640 Propanoate metabolism
    CEQ32_07820
   00650 Butanoate metabolism
    CEQ32_07820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEQ32_07820
   00072 Synthesis and degradation of ketone bodies
    CEQ32_07820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEQ32_07820
   00310 Lysine degradation
    CEQ32_07820
   00380 Tryptophan metabolism
    CEQ32_07820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CEQ32_07820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEQ32_07820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CEQ32_07820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shf04147]
    CEQ32_07820
Enzymes [BR:shf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CEQ32_07820
Exosome [BR:shf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEQ32_07820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PDT
Motif
Other DBs
NCBI-ProteinID: ASF14911
UniProt: A0A1Z4AAB0
Position
complement(1722769..1723959)
Genome map
AA seq 396 aa AA seqDB search
MSTEQFNQEIVIVAAKRTPMGGFQGSLSGVTSPSLAATAIKALLADTQVAGDKVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLLKAGSAKLVVAGG
MESMSQAPYLLDKARAGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEYGLTREQ
MDAFALSSLEKANAAITSGAFKAEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPALRPAF
AKDGTITAANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLSNVGWSKDEVDLFEINEAFAMVTMLAVSELGLDMAKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacaatttaaccaagagatcgttattgttgccgctaaacgcaccccaatg
ggtggctttcaaggcagtttgtctggcgtaacgtctccgagcttagcggccaccgccatc
aaagccctgttagctgatacccaagttgcgggtgataaggttgatgaagtgttaatgggc
tgcgtattgccagcgggtctgggtcaagcacctgcgcgtcaggcaaccttaggtgcaggt
ttacccctgtctgttggcgctacgaccgtaaacaaagtctgtggctctgggatgaaaacc
gtgatgcttgcccacgatttactcaaagcgggcagtgctaagttggtggttgctggtggt
atggaaagcatgagccaagctccttacttgctagataaagcgcgcgctggcatgcgtatg
ggccatggcaaggtcttagatcatatgttcctcgacggtttagaagatgcctacactggc
ggcgctatgggcacattcgcccagaaaactgccgatgaatacggcttaacccgcgagcaa
atggatgcctttgccctaagctcactggaaaaagccaatgcggctattacttctggcgcc
ttcaaggcggaaattgtacctgtgactgtgagcgatcgccgtggtgatgtgactatcgat
accgatgagcagcctggtaacgctcgccctgaaaaaatccctgcactgcgcccagcattt
gccaaagacggcactattacggcggcaaactcaagctctatttccgatggcgcggcagcg
ctgatgctaaccacccgcgccaatgccgagcagttaggcttaactgtgctggccaccatc
aagggccacaccacccatgcccaggagccatcactctttaccactgcgcccgttggcgcg
atggcaaaactgttgagcaatgtcggctggtctaaggacgaggttgacctgttcgaaatc
aacgaagcctttgccatggtgactatgctggccgtttctgaattaggtttagatatggcc
aaagtgaacgtgaatggcggtgcctgtgccttaggtcatcctatcggttgctcgggcgca
cgtttgctggtgaccttaattcatgcacttaaagcccgtgggcttaagcgcggcgtagcc
tcactctgtatcggtggcggtgaagcgaccgctatggcaatcgaagtctaa

DBGET integrated database retrieval system