KEGG   Shewanella sp. FDAARGOS_354: CEQ32_13975Help
Entry
CEQ32_13975       CDS       T04944                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shf  Shewanella sp. FDAARGOS_354
Pathway
shf00010  Glycolysis / Gluconeogenesis
shf00020  Citrate cycle (TCA cycle)
shf00620  Pyruvate metabolism
shf01100  Metabolic pathways
shf01110  Biosynthesis of secondary metabolites
shf01120  Microbial metabolism in diverse environments
shf01130  Biosynthesis of antibiotics
shf01200  Carbon metabolism
Module
shf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEQ32_13975 (aceF)
   00020 Citrate cycle (TCA cycle)
    CEQ32_13975 (aceF)
   00620 Pyruvate metabolism
    CEQ32_13975 (aceF)
Enzymes [BR:shf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CEQ32_13975 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RnfC_N PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ASF15982
UniProt: A0A1Z4ADX3
Position
complement(3107241..3109283)
Genome map
AA seq 680 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICASVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGASAQAAAPVAQAASPAPAPAAPAPVQAAPAPVAAATATGA
TQVVEVTVPDIGGDTDVSVIEVLVAAGDKIEVDAGLITLETDKATMDVPSPFAGVVKEVK
VAVGDKVSQGSLVIMLEVGGAAPAAAAPQASAPAASAPVAQAASSVTQAAAAVAPVAAAP
VVAVKEIQVPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATMEVPAPFAGKLLSL
TVKVGDKVSQGSVIATIETVTAGAAPAPVAQAAAPVSAPVAQEAAPAPVAAAPSRPPVPH
HPSAGAPVSTGAVHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKA
TAATSVAAGNGGGLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFD
EADITEMEEFRKQQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQ
KKYYHIGVAVDTPNGLVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTI
SSLGGIGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAM
AARFSVTLSGILSDIRTLIL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtacaagttatc
gaaatctgtgcttctgtgggcgataccttagcagcggaagagtcgattctgaccgttgaa
agcgacaaggcgaccatggacattcctgcgcctttcgcgggtgtgttagccgaattgaaa
gtggccgtcggtgacaaagtcagcgaaggtaccttaattgcgatgatgcaagcagcgggc
gcatccgctcaagctgctgcgccagttgctcaagctgcctctcctgcgccagctccagca
gcacctgctccagtacaagcggctcctgcccctgtagctgccgcgacagcgacgggcgca
acccaagtggttgaagtcactgtgccggatatcggtggtgacaccgatgtgtctgttatc
gaagtcttagttgccgctggcgataagattgaggttgacgctggccttatcacgcttgaa
accgacaaagcgactatggacgtaccatcgccattcgcgggtgtggtaaaagaagtgaaa
gtggctgtgggtgacaaggtttcccaaggctcattagtgatcatgctcgaagtgggtggc
gcagctcctgctgccgctgctccacaagcaagcgcgccagcagcatcagctcctgtcgct
caagcggcatcttccgtcacacaagcagcagcggctgttgctccagtagctgctgcacca
gtggttgccgttaaagaaatccaagtgccagatattggtgatgccagcaatgtcgatgtg
atcgaagtgctagtgtctgtgggtgatatgatcactgctgaccaaggtttgatcacgtta
gaaaccgataaagcgaccatggaagtgcctgcgccattcgccggtaaactgttgtcgtta
accgttaaagtgggtgataaggtttctcaaggtagcgtgattgcgacgattgagactgtg
actgctggtgcagctcctgcgccagtagctcaagccgcagcgccagtttctgcacctgtc
gcccaagaagcggcaccagcacctgttgcagccgcgccgagccgtccaccggttccacat
cacccaagtgcaggtgcgcctgtgtctactggtgcggttcatgcgtctcctgcggttcgc
cgtttggcccgtgaatttggtgtggatcttactcaagtgacgggttctggccgtaaaggt
cgcatcatgaaggaagacgttcaggcgtatgtgaaatacgaactgtctcgtcctaaggcg
acagcggcaacttccgttgcagcgggtaacggtggtggtctgcaagtgattgccgcaccg
aaagtggatttcagcaagtttggtgaagtggaagagattccattaagccgtatccagaaa
atctctggtccaaacctgcaccgcaactgggtaactattcctcacgtgactcagttcgat
gaagctgatatcactgaaatggaagagttccgtaagcagcagaacgacgcggcggcgaag
aagaaagccgattataagatcactccgctggtctttatgatgaaagctgtggcgaaaacg
ctgcaacagttcccagtgttcaactcaagcttaagcagcgacggtgaatcactgatccag
aagaagtactaccacatcggtgtggcggttgatacgccaaacggtttggttgtgccagtg
gtgcgtgacgtggataagaaaggcattatcgagttatctcgtgagctggccgatatttct
atccgtgctcgcgatggtaagctcaaatctgctgatatgcagggtagctgcttcactatt
tcaagcctaggtggcattggtggtactgcatttaccccaatcgttaactacccagacgtg
gcgattttaggtgtgtctaaatctgaaattaagcctaagtggaatggtaaagagttcgag
cctaaattgatgttgccactgtcgctatcctacgatcaccgcgtgatcgatggtgcaatg
gctgcacgctttagcgtgaccctgtcaggaattctgtccgatattcgtactttgattctg
taa

DBGET integrated database retrieval system