KEGG   Sphingobacterium sp. 21: Sph21_0595Help
Entry
Sph21_0595        CDS       T01450                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00010  Glycolysis / Gluconeogenesis
shg00052  Galactose metabolism
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_0595
   00052 Galactose metabolism
    Sph21_0595
Enzymes [BR:shg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sph21_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADZ77175
UniProt: F4C8Y6
Position
complement(735499..736641)
Genome map
AA seq 380 aa AA seqDB search
MKIKYYVYYILGCIALSCNNPARENNANERSVKETTAFDSQIDGKEAKLYTISNGKGLTA
TLTNYGGRVVSLTVPDKDGKPVDVVLGFATAAEYKAASEPYYGATIGRVGNRIAKGKFEL
DGKEYSIFTNNGQNTLHGGKKGFQDVVWDAEQASDSSLVLRYRSPDGEENFPGNLEVKIT
YTATANNGLRFDYEATTDKRTPVNLTNHAFFNLNGEGSGTINNHLLQIKADRYTPVDSTL
IPLGNLASVKNTPFDFTTAQAIGSRVDQDNEQLKFGGGYDHNFVLNKGNKYGLAATVTGD
KSGIVMQIFTDEPGLQFYGGNFMKGQNTLKSGVKDDYRTSFALETQHFPDAVNQPDFPSI
ILDPGKVYKTTSEYVFSVTK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaaatactatgtttattacatattgggctgtatagccctttcgtgtaataac
cccgcaagagaaaacaacgcaaatgagcgcagcgtaaaagaaacaacagcgtttgatagc
caaatcgatggtaaagaagcgaagctttatacaatcagcaatggaaagggattaaccgca
acactcacgaattatggtggcagagttgtcagtttaaccgtaccggataaagatggtaag
cctgttgacgtcgttttaggttttgcgacagcggcggaatacaaggccgcttcagagcca
tattatggtgcgacgatcggccgtgtagggaatcggatagcgaaagggaaatttgaattg
gatggaaaagaatatagtatctttaccaataatgggcaaaacaccttgcatggcggaaaa
aaaggatttcaggacgtagtgtgggatgcagaacaagcaagcgactcttcacttgttttg
cgataccgttcacccgatggtgaggaaaattttccaggaaacttagaagttaaaataacc
tataccgccactgccaataatggattgcggtttgattacgaggcaactactgataaacgc
acgcctgttaatcttacaaaccatgctttctttaatctgaacggggaaggctcgggcacc
attaataatcatcttctacaaataaaggcagatagatatacaccggttgacagcaccctg
attccgctgggtaatttagcttctgtcaagaatacgccctttgacttcacaacagcgcaa
gccattggtagccgcgtagatcaggacaatgagcaattaaaattcggaggtgggtacgat
cataattttgtactcaacaaagggaataagtatggtttagcagctactgttacgggtgat
aagagtggcattgttatgcagatctttaccgacgaaccgggattgcagttttatggaggc
aattttatgaagggacaaaataccctgaaaagcggcgtgaaggatgactatcgaacatct
tttgctttagagactcagcattttccggatgccgtaaatcaaccggactttccgtcgatc
attctggacccgggcaaggtctacaaaacgacttcggagtacgtcttttccgttactaaa
tag

DBGET integrated database retrieval system