KEGG   Sphingobacterium sp. 21: Sph21_1168Help
Entry
Sph21_1168        CDS       T01450                                 

Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00260  Glycine, serine and threonine metabolism
shg00630  Glyoxylate and dicarboxylate metabolism
shg00670  One carbon pool by folate
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sph21_1168
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sph21_1168
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Sph21_1168
Enzymes [BR:shg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Sph21_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ADZ77737
UniProt: F4CDK2
Position
1449345..1450424
Genome map
AA seq 359 aa AA seqDB search
MKTTALTDLHIALGAKMVPFAGYNMPVQYTGINDEHQTVRTGVGVFDVSHMGEFILKGER
ALELVQKISSNDASKLFDGKIQYACIPNETGGIVDDFLVYRIDAKTYLLVVNASNIQKDW
DWISKYNTFGVEMKDISDKTSLFAVQGPKATEALQSLTSLDLGEMEYYTFKKGVFAGIDN
VLVSATGYTGAGGFEIYVDNEHAKEVWEAIMNAGKPFGIKPIGLGARDTLRLEMGFCLYG
NDIDDTTSPLEAGLGWVTKFTKDFVNAENLKKQKEEGIQRKLVGFEMIERGIPRHGYELV
NENDQPIGHVTSGTQSPTLQKSIGLGYLSKEYSKEGTEIYVKIRDKKVKAVVSKPPFIK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaccgccctcacggatttacacatagcgctcggtgctaagatggtacccttt
gcaggctacaacatgcccgtacaatacacgggtatcaatgatgaacatcaaacggttcgt
accggtgtaggcgtgttcgatgtaagccatatgggcgagttcatattaaaaggagaaaga
gcattggaattagtacagaaaataagttccaatgatgcgtcaaagctttttgatgggaaa
attcaatatgcctgtatacccaacgaaacaggaggtattgtcgatgattttctggtttat
cgtatagacgcaaaaacgtatttactcgtcgtaaatgcctctaatatacaaaaggattgg
gactggatttcaaaatacaacacctttggtgttgaaatgaaagacatttctgataaaact
tccctgttcgcagtacaaggccctaaagcgacagaagcattgcagagcctaacaagccta
gatttgggagaaatggaatattatacctttaaaaaaggtgtatttgccggcatagataat
gtgttagtttccgctacaggatataccggtgccggaggattcgaaatttatgttgacaat
gaacatgcgaaagaagtgtgggaggctattatgaacgccggtaagccttttggaatcaag
ccaattggtttaggggcacgcgatacgctacgtcttgaaatgggtttctgtttatatgga
aatgatatcgatgataccacttcaccactcgaagcgggtttgggatgggtaaccaaattt
acaaaggactttgtaaatgctgaaaacttaaaaaaacaaaaagaagaaggaatacagcgt
aaattagttggatttgaaatgattgagcgtggcattccaagacatggctacgaacttgtt
aacgaaaacgaccaaccaattgggcatgttacttccggcacccaatctccaacgcttcaa
aagtcaatcggattaggttatctaagtaaggaatatagcaaagaaggaactgaaatttac
gtcaaaataagagataaaaaagtaaaggctgtggtaagtaagcccccttttattaaataa

DBGET integrated database retrieval system