KEGG   Sphingobacterium sp. 21: Sph21_1371Help
Entry
Sph21_1371        CDS       T01450                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
shg  Sphingobacterium sp. 21
Brite
KEGG Orthology (KO) [BR:shg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Sph21_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADZ77934
UniProt: F4CFB8
Position
1701611..1702618
Genome map
AA seq 335 aa AA seqDB search
MLTILVVVIVLAVAFDYINGFHDAANSIATIVSTKVLTPFQAVLWAAAFNFAAYFYFTDH
KVANTIAKTVVENYITLEVILAGLIAAISWNLFTWYYGIPSSSSHTLIGGFAGAGMAHAL
FLGDSIMGAINLGPTLKIISFIVLAPVIGMLISIVITLIILHLAKRSRPAVAEKWFKRLQ
LVSSAALSFAHGGNDAQKVMGIIVVAMVAGGYLPNADHMPEWIPLTCYSAIALGTMSGGW
KIVKTMGTKITKVTALEGVGAETAGALTLGITEHFGIPVSTTHTITGSIIGVGLVKRVSA
VRWGVTISLLWAWVLTIPVSAILAGITYGIMHYIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccatactggtcgttgttattgtgctagccgttgcttttgattatataaacggt
ttccatgatgcagctaattccattgccaccattgtatcaactaaagtgctgacacctttt
caggctgtgctttgggcagcagcatttaattttgcggcttatttctattttacagatcac
aaagttgccaatacgatagcgaagacagtagttgaaaattatattacgttagaagttatc
ctagccggattgattgctgccatcagctggaacttatttacctggtattacggaattcct
tccagctcctcacatacgctgatcggtgggtttgcaggtgcgggcatggcccatgcgcta
tttctgggtgattccattatgggtgccatcaacttaggacctaccctaaagataatttct
ttcattgtgttggcccctgtaattggtatgctgatatcaattgttataacgctgataatt
ttgcacttggcaaaacggtctcgcccggcggttgcagaaaaatggtttaagcgattgcag
ttagtttcgtcggccgctttgagctttgctcacggaggaaacgatgcgcaaaaggttatg
ggaattattgtagttgccatggtagcaggcgggtatttaccaaatgccgatcatatgccg
gaatggatccctttaacctgttatagtgcgatcgcattaggaaccatgagcggtggatgg
aaaattgtaaaaacaatgggaacaaaaatcacgaaagtgacagctttagagggagttggt
gccgaaacagcgggagccttgaccctaggaattaccgagcacttcggaatcccggtttct
acaacccacacgattacaggttccattataggtgttggtttggttaagcgtgtgtcggct
gtccgttggggcgtaacaatcagtttgctatgggcatgggtactaaccattcctgtatcc
gcaatcttggcgggcatcacttatggcattatgcattatattttataa

DBGET integrated database retrieval system