KEGG   Sphingobacterium sp. 21: Sph21_1685Help
Entry
Sph21_1685        CDS       T01450                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00020  Citrate cycle (TCA cycle)
shg00310  Lysine degradation
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Module
shg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sph21_1685
  Amino acid metabolism
   00310 Lysine degradation
    Sph21_1685
Enzymes [BR:shg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sph21_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADZ78247
UniProt: F4C6T1
Position
2065996..2067555
Genome map
AA seq 519 aa AA seqDB search
MAIEIKVPAVGESITEVTLSQWLKKDGDYVEMDENLAELESDKATFELPAEKAGILRIIA
KEGDTLEIGAVVCTIEEADGKGASTTQNNTTPTATPEAKPATQDNGSTGAPVEIKVPTVG
ESITEVTLSQWLKKDGDYVEMDEDLAELESDKATFELPAEVAGTLQIVAQEGDTLAIGAV
VCKIIPSGKGAAAAASSSASAPATAKEEEEEKEQNYAAGTPSPAAAKILKEKGIDPSTIK
GTGKDGRITKEDALKAEKKAVEPKPAATASAPKAEPSTTAPKAAAGSRDERREKMSSLRK
TIAKRLVSVKNETAMLTTFNEVDMKPIMDLRAKYKDKFKDKYGVGLGFMSFFTKAVTTAL
AEWPAVNARIEDNEIVYSNFADISIAVSAPKGLVVPVIRNAESMTLDEIEKAVRDLALKA
RDNKLTIDEMTGGTFTITNGGVFGSMMSTPIINAPQSAILGMHNIVERPVAINGEVVIRP
MMYVALSYDHRIVDGRESVSFLVRVKELLEDPARLLLGI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaaataaaagttccagccgtaggcgagtcgataacggaagttaccttatct
caatggctgaaaaaagatggcgactatgtagaaatggatgaaaatttggctgaattagaa
tccgataaagccacctttgaattaccggctgaaaaggctgggatactccgtattattgct
aaagaaggggataccttggagattggtgcggttgtctgcaccattgaagaggcagatggt
aaaggcgcaagcacaacacaaaataatactacgccaacggctacaccggaggcaaaaccg
gccactcaagataatggttcaaccggagctcctgttgaaattaaagtgccgactgtgggc
gagtcgatcaccgaagtgaccttgtcgcaatggctgaaaaaggacggtgattacgtagag
atggatgaagatttggcggaactggaatcggataaagcaactttcgaactgcctgctgag
gtagcagggactttacagattgttgcacaagagggtgataccctcgctataggtgcagta
gtttgtaagattattccgtctggtaagggcgcggcagctgctgcctcaagcagcgcgtca
gctccggctacagcaaaggaagaggaagaagaaaaggaacaaaactatgctgccggaaca
ccttcacccgctgctgctaagattttaaaggagaaaggaattgacccaagtaccattaaa
ggaaccgggaaggacggacgtattacaaaagaagatgccttaaaagccgagaaaaaggcc
gttgagccaaaaccggcagcgacagcgtcggctcctaaggctgaaccatcgacaacagca
cctaaagctgctgccggttcgagagatgaacgtagggagaaaatgtcttcactccgtaag
acgatagccaagcgtttagtttctgttaaaaatgaaacggcgatgctgactactttcaac
gaagtggacatgaagccgatcatggatctgcgcgcaaagtataaggataaattcaaagat
aaatatggtgtgggcctcggctttatgtcattcttcacgaaagccgtaacgacggccttg
gcggagtggcctgcagtaaatgcacggatcgaggataacgagattgtatatagcaatttc
gcggacatctctatcgcggtttctgcaccgaaaggtttagtggtaccggtaatccgtaat
gcagagtccatgaccctagacgaaatcgaaaaagcagttcgcgatttggccttgaaagcg
cgggataacaaattgactattgatgaaatgaccggtggtacctttaccatcaccaacggt
ggtgtgttcggatccatgatgtctacaccgattatcaatgcccctcaatcagccatccta
ggaatgcataacatcgtggaacgtccggtagccattaatggtgaggtcgtgattcgtcca
atgatgtatgtcgccctgtcttatgaccaccgcatcgttgacggacgggaatctgttagt
ttcttggttcgggtgaaggaattgttggaagaccctgctcgtttattattgggcatttaa

DBGET integrated database retrieval system