KEGG   Sphingobacterium sp. 21: Sph21_2161Help
Entry
Sph21_2161        CDS       T01450                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00630  Glyoxylate and dicarboxylate metabolism
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sph21_2161
Enzymes [BR:shg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Sph21_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADZ78716
UniProt: F4CCC3
Position
2651549..2652793
Genome map
AA seq 414 aa AA seqDB search
MERIIAKYYIETPFDPEKAALTLAGEQSSGTFVSVPGETEDLKRRFAARVESVHLLGSVS
QPAIPSPKFTSERYQRAYIEISWSIENFGYNLPVLISTLQGNLYELSQFTGLKLLDIQFP
ASYIAHFEGPRFGVAGSRASTKVDGRPLIGTIIKPSIGMSPSDSARLVKTLVEAGIDFIK
DDELQSAAANSKLEDRVDAIMRVINAHADKTGKKVMYAFNISDELDSMLSRYDYIVKAGG
TCAMLSINSVGLAGVKKICDQGALVIHGHRNGWGMLNRHPLLGIEFTAYQKLWRLAGVDQ
LHVNGIQNKFWESDDSVVQSIEACLTPLFSRETLLPVVSSGQWGGQAFETYRRTKTIDLL
YMAGGGIMAHPKGPGGGVVALQQAWEGAVKGLVMEEAVRLYPEFAQSVQKFGQQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaattattgcgaaatactatattgaaactccctttgatccggaaaaagcggct
ttgaccttggcgggcgaacaatcatcgggtacctttgtgtcagttcccggtgaaacggaa
gatctaaagcgacgctttgctgcgcgtgtggaaagtgttcacctgctgggatcggtttca
cagccggccattccgagcccgaagttcacatccgaacggtatcaacgagcttatatcgaa
atctcctggtcgatagaaaattttggctataatttaccggtgcttatttccactttgcaa
gggaatctctatgagctcagtcagttcacgggtttgaaactattggatattcaattcccg
gcatcctatatcgctcattttgaagggcctcgttttggagtggccggttcccgagcaagt
acaaaggtggacggacgacccttgatcggcaccattattaaaccgagtattggcatgagc
ccttcggatagtgctagattggtgaaaaccttggtggaggccggtattgactttataaaa
gatgacgaactgcaatcagcagcagctaactccaagttggaagatcgggttgacgccatt
atgcgtgtcatcaatgcgcatgcggacaaaaccgggaaaaaggtcatgtatgcttttaac
attagcgatgaattggatagcatgttgtctcgttatgactatatcgttaaggcaggcggt
acctgcgccatgctcagtatcaatagtgttggccttgctggcgtaaaaaaaatatgtgat
cagggtgcattggttatccacggtcatcggaatggttggggtatgctgaataggcacccc
ctgctgggtattgaatttacggcctaccaaaaactttggcgcttggcaggcgtagatcag
ctacatgtaaatggaattcagaataaattctgggaatcggatgattcggtggtacagtcc
atcgaagcttgcttaacgcctttattttctcgtgaaacattattgcccgtggtatcttcc
ggccagtggggagggcaagcctttgaaacctacaggcgtacgaaaaccattgatttattg
tacatggcaggaggcgggattatggcgcatcccaaaggtcccggtgggggtgtggtggcc
ttgcaacaggcttgggagggcgcggttaaaggacttgtcatggaagaggccgttcgacta
tatcctgaatttgcccaatcggttcaaaaatttggtcagcaataa

DBGET integrated database retrieval system