KEGG   Sphingobacterium sp. 21: Sph21_3045Help
Entry
Sph21_3045        CDS       T01450                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00010  Glycolysis / Gluconeogenesis
shg00051  Fructose and mannose metabolism
shg00562  Inositol phosphate metabolism
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
shg01230  Biosynthesis of amino acids
Module
shg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shg_M00002  Glycolysis, core module involving three-carbon compounds
shg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_3045
   00051 Fructose and mannose metabolism
    Sph21_3045
   00562 Inositol phosphate metabolism
    Sph21_3045
Enzymes [BR:shg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sph21_3045
Exosome [BR:shg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sph21_3045
  Exosomal proteins of bladder cancer cells
   Sph21_3045
  Exosomal proteins of melanoma cells
   Sph21_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ79590
UniProt: F4C5D3
Position
3785189..3785953
Genome map
AA seq 254 aa AA seqDB search
MRKKIVAGNWKMNMDYQEGISLFSEVANMVKDEVIGNQQIIVCSPFIHLHSIASLAKESE
NVSVGAQNIHQEDAGAYTGEISAKQVRSTGAEYVILGHSERRAYFGESDELLAQKVNIAL
THGLIPIFCIGETREERESGDFFDVIKTQLEKGVFHLSASDFSKIILAYEPVWAIGTGLT
ASPEQAQEVHAFIRKQIEAKYGAAVADETSVLYGGSCNPKNAPDLFSQPDIDGGLIGGAS
LKSRDFTDIVKVFN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaattgttgccggtaattggaagatgaacatggattaccaagaaggaata
agcctgttttcagaagtggctaacatggtaaaagatgaggttattggtaatcagcaaata
attgtttgcagtccttttatccatttacatagtattgcttctttagcaaaagagagtgaa
aatgtgtctgtgggtgctcagaatatacatcaggaagatgcaggtgcatacacaggggaa
atatcagcaaagcaagtacgctcgacgggcgcggagtatgtaatattagggcattctgaa
agaagggcttatttcggcgaatctgacgagttactggcacagaaagtaaatatagcactt
acacatggcctgatcccgattttttgtataggcgaaacaagagaagagcgcgaatccggt
gatttttttgatgttatcaaaacgcaattagagaaaggtgttttccatctgtcggcaagc
gacttttctaaaataatcctagcttatgagccggtttgggcaattggtaccggattgact
gcaagcccggagcaagcacaggaagtacacgctttcattagaaagcagattgaagcaaaa
tatggtgcagctgtagcggatgaaaccagtgtgctatacgggggaagctgtaatcccaaa
aatgctccggatttattttcacaacctgacatcgatggtggcttaattggcggtgcctca
ttaaaatcaagagactttactgatatagtaaaggtttttaactaa

DBGET integrated database retrieval system