KEGG   Sphingobacterium sp. 21: Sph21_4842Help
Entry
Sph21_4842        CDS       T01450                                 

Definition
(GenBank) hypothetical protein
Organism
shg  Sphingobacterium sp. 21
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA UME
Motif
Other DBs
NCBI-ProteinID: ADZ81349
UniProt: F4C6C6
Position
complement(5758249..5758695)
Genome map
AA seq 148 aa AA seqDB search
MFNYEIGGNERKIDASEAFADIAHNKTLFVQKLTDSDPIKPEKVEGLKTVQDVFNHYEPQ
VQVEFENQDGTLIPETLRFANLGDFAAQSMIKQSRHLNNVQIEKEMSISVLKQLKSNRTL
QTTLANEETKNAFVNALKSFIRELEEND
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtttaattacgaaatcggcggaaatgaacgcaagatagacgcttcggaggcatttgca
gatatagcgcacaataagactttgtttgtacagaagcttacagatagtgatccgataaaa
ccggaaaaggtggaaggattaaaaacggtgcaagatgtattcaaccattatgaaccgcag
gttcaggttgaatttgaaaaccaagacggaacgctgattccagagacacttcgtttcgcc
aatttaggtgattttgcagcgcaaagtatgattaaacaaagtcgacacttaaataatgta
cagatcgaaaaagagatgtctattagtgttcttaagcaactcaagtcgaatagaaccttg
cagactacattagcgaacgaggagactaaaaacgcatttgtcaatgcgctcaaaagcttt
atacgcgaattagaagaaaacgattaa

DBGET integrated database retrieval system