KEGG   Sphingobacterium sp. 21: Sph21_4845
Entry
Sph21_4845        CDS       T01450                                 

Definition
(GenBank) PKD domain containing protein
Organism
shg  Sphingobacterium sp. 21
SSDB
Motif
Pfam: PKD_4 PKD PKD_3
Other DBs
NCBI-ProteinID: ADZ81352
UniProt: F4C6C9
Position
complement(5763615..5764571)
AA seq 318 aa
MTTLTRSNTQAEGRGTLHYLFLYFMLAIILLVCIIMLLRNYFFYERKVNATVLKNELYLN
EKLLFTDNTEGAENWLWEFGNGQHSERQNGSYQYTAAGSYIVRLTVDNQLRVQFPVVVKD
TVAGIRDTALTVNGPTSGIVNEEIRLEAVGAGTQFEWSFGETGRIDVKGRSALYRFHNPG
KYLVQLRSDRSRPVNHLMHITDPSLDTVLVVPGEGEKVIVDDIRARLQAIADGADFNTNY
YYLVRRYLCGNEKVSVSIEQDNLKRTDDFYSYCMGLTFSQEIYVDQAQLVTSPNAACATL
LSIKQHTSEKIRARLKSE
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacgactttgacgcgatcgaatacgcaagcggaagggcgaggtacgcttcactatctg
ttcttatatttcatgctggctattattctgctggtttgcattattatgctccttagaaac
tattttttctatgaacgtaaagttaatgccacagttctgaagaatgagctttatctgaat
gaaaaattgctatttacggataataccgaaggtgcggaaaattggctatgggaattcgga
aatggtcagcattcggagcggcaaaatggaagttaccaatatacggccgccggttcctat
atcgttcggttaaccgttgataatcaattgcgtgttcagtttccggtagtggtgaaagac
accgtggcaggtatacgggatactgctctgacggttaacggtccgacgtcaggtatagta
aatgaagaaatcaggttggaggctgtgggtgccggaacgcagttcgaatggtccttcggt
gaaactgggaggatagacgtgaaaggacgctccgctctatatcgttttcataatccggga
aagtacctggttcaacttcgaagtgatcgaagccgaccggtaaatcacttgatgcatatc
actgatccgagtttggacacggtattggtggttccaggtgaaggtgagaaggtgatcgtt
gacgacatcagggcgcgtttacaagccattgccgatggcgctgattttaatacgaactat
tattatctcgtacgccgctatctatgtggaaatgaaaaagtcagcgtctcgatcgagcaa
gataaccttaaaaggacagatgatttttactcttattgcatggggcttaccttttcgcaa
gagatttacgtcgatcaagcgcagcttgtgacgagtccgaatgccgcatgcgccacgctc
ctgagcatcaaacagcatacttcggagaaaatacgggccaggttaaagtcagaataa

DBGET integrated database retrieval system