KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_00408Help
Entry
ShL2_00408        CDS       T03837                                 

Gene name
paaJ
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00071  Fatty acid degradation
shh00072  Synthesis and degradation of ketone bodies
shh00280  Valine, leucine and isoleucine degradation
shh00310  Lysine degradation
shh00362  Benzoate degradation
shh00380  Tryptophan metabolism
shh00620  Pyruvate metabolism
shh00630  Glyoxylate and dicarboxylate metabolism
shh00640  Propanoate metabolism
shh00650  Butanoate metabolism
shh00900  Terpenoid backbone biosynthesis
shh01100  Metabolic pathways
shh01110  Biosynthesis of secondary metabolites
shh01120  Microbial metabolism in diverse environments
shh01130  Biosynthesis of antibiotics
shh01200  Carbon metabolism
shh01212  Fatty acid metabolism
shh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ShL2_00408 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    ShL2_00408 (paaJ)
   00640 Propanoate metabolism
    ShL2_00408 (paaJ)
   00650 Butanoate metabolism
    ShL2_00408 (paaJ)
  Lipid metabolism
   00071 Fatty acid degradation
    ShL2_00408 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    ShL2_00408 (paaJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ShL2_00408 (paaJ)
   00310 Lysine degradation
    ShL2_00408 (paaJ)
   00380 Tryptophan metabolism
    ShL2_00408 (paaJ)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ShL2_00408 (paaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ShL2_00408 (paaJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ShL2_00408 (paaJ)
Enzymes [BR:shh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ShL2_00408 (paaJ)
Exosome [BR:shh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ShL2_00408 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKC75287
UniProt: Q9FD81
Position
442421..443572
Genome map
AA seq 383 aa AA seqDB search
MKKIAIVSAKRTPIGRYKGKLRNYSAVELGTTALKGAIDSANIDPNIIQQVIFGNVLQSG
VGQNPARQIAIKAGVPDTTPAMTINEVCGSGLKAIILGKQLIQLGEADVVAVGGVESMTN
APQLILKEGQEPVESFMHDGLTDAFHYVPMGVTAENIAEKYDITREMQDEFANHSQAKAA
KATQDGKFNNEIIGMTDAEGEQMTSDEGVRPNSSVEKLATLKTIFKEDGTVTGGNASSIN
DGSSALILMEESYAKAHGYDILGIVGDYAEVGCDPQYMGYAPFYAVEKLLDKTDSKIDDV
DIVEMTEAFAAQSIPVKDNLHIPDEKLNIYGGAIALGHPIGASGARLVTTLVNALEQENK
RTGIATACIGGGLGIALMIDKGE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctatagttagtgctaaaagaacgccaatcggtagatataaaggtaaa
ttaagaaattattctgcagttgaattgggaacgacagctttgaaaggtgcaatcgattca
gcaaatattgatcctaatataatacaacaagttattttcggtaatgtgctacaaagtggt
gtaggacaaaacccagcacgtcaaattgcgattaaagcgggtgtacctgatacaacacca
gctatgacaattaatgaggtatgtggatcaggtcttaaagcaattatattagggaaacag
ttaattcaattaggtgaagcggatgtagtagcagtgggtggagttgaaagtatgacaaat
gccccacaattaatcttaaaagaaggtcaagaaccagtggaaagttttatgcatgatggt
ttaacagatgcctttcattatgtaccaatgggtgtaacagctgagaacatagctgaaaaa
tatgacatcacgcgtgaaatgcaagatgagttcgcaaatcattcacaagctaaagcagct
aaagcgacgcaagatggtaaatttaataatgaaatcatcggtatgactgacgcagaaggg
gaacaaatgacttctgatgaaggtgttcgcccaaatagtagtgttgagaagcttgcgaca
ttaaagacaattttcaaagaagatgggacagtaactggtggtaatgcttcaagtattaat
gatggttcatctgcactcattttaatggaagaatcatatgctaaagcgcatggttacgat
attttaggaattgttggagattatgcagaagtaggttgtgacccacaatatatgggctat
gcgccattctatgctgttgagaagctacttgataaaacggatagcaaaatcgatgacgtt
gatattgtagaaatgactgaagcatttgctgcacaaagtataccagtcaaagacaatttg
catattccagatgaaaaattaaatatctatggcggtgctattgcactaggacacccaatt
ggtgccagtggtgctagattagtcactactttagtgaacgcacttgaacaagaaaataaa
cgtacgggtattgctacagcatgtattggtggaggactaggtatcgctctaatgattgat
aaaggggaataa

DBGET integrated database retrieval system