KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_00504Help
Entry
ShL2_00504        CDS       T03837                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:shh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ShL2_00504
Enzymes [BR:shh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ShL2_00504
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ShL2_00504
    1.1.1.-  
     ShL2_00504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C MTS
Motif
Other DBs
NCBI-ProteinID: AKC75380
UniProt: A0A2A1KCE7
Position
complement(541735..542778)
Genome map
AA seq 347 aa AA seqDB search
MKAAVWYGQKDVRVEDREPKQLKDNEVKVKVSWAGICGTDLHEYLEGPVFISTDKPDPLL
GQKAPVTLGHEFAGVVEEVGKDVTKYKKGDRVVVNPTVSKHEKDESVDLYDGYSFIGLGS
DGGFAEFTNAPEENVYALPESVSDKEGALVEPTAVAVQAVKEGKLLFGDTVAVFGAGPIG
LLTIVAAKAAGASKIFVFDLSEERLAKAKEVGATHVVNSGNTNPVDFINEHTENGVDVTF
EVAGVGVTLSQSVQVTRPRGTVVIVSIFAHAVDFDPMLLTNSGVQLTSTIAYSPTTFQQT
IDLIANGSLDVKSVVTDEIELENIVESGFEQLVNDKSQAKILVKLNG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggtcaaaaagatgttcgcgtggaagatcgtgaacctaag
caattaaaagacaatgaagttaaagtaaaagtttcatgggcaggtatttgcggaactgat
ttacatgaatacttagaaggaccagtcttcatctctacagataaacctgatccactactt
ggacaaaaagcacctgttactttaggacatgagtttgctggtgttgttgaagaagttggt
aaagacgttactaaatataaaaaaggtgaccgcgtagttgttaacccaactgtatctaaa
cacgagaaagatgaaagcgttgatttatatgatggctattcatttatcggtttaggctct
gatggtggctttgccgaatttacaaatgcgccagaagaaaatgtatatgcattacctgaa
agtgtatctgataaagaaggtgctttagtagaacctactgcagttgcggttcaagcagtt
aaagaaggtaaattattatttggtgatacagtagcagtatttggtgctggcccaattggt
ttattaacaattgttgcagctaaagcagctggtgcaagtaaaatcttcgtatttgattta
tctgaagaacgtttagctaaagctaaagaagtcggcgctacgcatgtagttaactctggt
aatacaaatcctgtagactttattaacgaacatacagaaaatggtgtagatgttacattt
gaagttgctggtgttggtgtaacattatctcaatctgtacaagttacgcgtccaagaggt
acagttgtcatcgtatcaatctttgctcatgcagtagatttcgatccaatgttattaact
aactcaggtgttcaattaacttctacaattgcatactctcctactacattccaacaaaca
attgatttaattgcgaacggtagtttagatgttaagagcgtagtaacagatgaaatcgaa
ttagaaaacattgttgaatctggattcgaacaattagtaaacgataaatctcaagctaaa
attttagttaaattaaatggttaa

DBGET integrated database retrieval system