KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_00694Help
Entry
ShL2_00694        CDS       T03837                                 

Gene name
fabG_1
Definition
(GenBank) 3-oxoacyl-ACP reductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00030  Pentose phosphate pathway
shh01100  Metabolic pathways
shh01120  Microbial metabolism in diverse environments
shh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ShL2_00694 (fabG_1)
Enzymes [BR:shh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     ShL2_00694 (fabG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Polysacc_synt_2 THF_DHG_CYH_C ApbA CBM_21
Motif
Other DBs
NCBI-ProteinID: AKC75562
UniProt: A0A2A1KH22
Position
complement(734890..735681)
Genome map
AA seq 263 aa AA seqDB search
MFSDLEGKVVIITGAGSGIGKSFAENFGKSKAKVVLNYRSDRHLDEIEEIKHMISNAGGE
AIAVQADVAVEEDVKRLVQSAVKEFGTLDIMINNAGFEKPIPTHKMSVDEWQKMIDINLT
GAFVGSREAVNQFLKEDKKGIIINTSSVHDTIPWPNYVNYAASKGGLKLMMETMSMEYAQ
YGIRINNISPGAIVTEHTKEKFSDPETRAETLEMIPAKEIGEAQDVANVALFLASDLANY
IHGTTIYVDGGMTNYPAFMGGKG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagatttagaaggtaaagtcgtaattataactggtgctgggagtggtattggt
aaatcctttgcagaaaactttggtaaatcaaaagcaaaagtagttttaaattatcgctct
gaccgtcatttagatgaaattgaagaaattaagcatatgattagtaatgctggtggtgaa
gcaattgccgtacaagctgatgtggctgtcgaggaagatgtaaaacgattagttcaatct
gctgttaaagaatttggcacgctagatattatgataaataatgcaggatttgaaaaacct
atcccaacccataaaatgtcagttgatgaatggcaaaaaatgatagatattaatttaact
ggtgcattcgtaggttctagagaagcagttaatcaatttttaaaagaagataaaaaagga
ataatcatcaatacatcaagtgtacatgatacgattccatggcctaattatgtcaattat
gctgctagtaagggtggcttaaagttaatgatggaaacaatgtctatggaatacgcacaa
tatggtatacgcataaacaacatttctccaggtgcgatagtcactgagcatactaaggag
aaattctctgatccagaaactcgtgctgagacattggaaatgattccagctaaagaaatt
ggtgaagctcaagatgtagctaatgtggcattattcttagcttcagatttagcgaactat
attcacggtactacaatttacgttgatggtggtatgactaactaccctgcctttatgggt
ggtaaaggttaa

DBGET integrated database retrieval system