KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_00831Help
Entry
ShL2_00831        CDS       T03837                                 

Gene name
tenA
Definition
(GenBank) thiaminase-2
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00730  Thiamine metabolism
shh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ShL2_00831 (tenA)
Enzymes [BR:shh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     ShL2_00831 (tenA)
Transcription factors [BR:shh03000]
 Prokaryotic type
  Other transcription factors
   Others
    ShL2_00831 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Herpes_UL74
Motif
Other DBs
NCBI-ProteinID: AKC75697
UniProt: A0A2A1KBN6
Position
864712..865401
Genome map
AA seq 229 aa AA seqDB search
MTFSTEIKEAAQPIIEEIYNDGFIQDLLKGDLDAQAVRQYLRADASYLKEFTNLYALLIP
KAPSMKDVKFLVEQIEFMLDGEVEAHEILADYINEPYEEIVKEKVWPPSGDHYIKHMYYH
AYAHENAAYTIAAMAPCPYVYEVVAKMALDDQNLNRDSVTSKWFDFYSTEMRPLIEVFDN
LLDELTANCTEQEKKDIKESFLQSTIHERNFFNMAYINEQWNFGGDKNA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcaactgagattaaagaggctgcgcaacctattattgaagaaatttataat
gatggttttatacaagacctattaaaaggggatttagatgctcaagcagtacgtcaatat
ttaagagcagatgcatcatatttgaaagaatttacaaatttatatgcacttcttatccca
aaagcgccatcaatgaaggatgttaaatttttagttgaacaaattgaatttatgcttgat
ggtgaggttgaggcacatgaaatcctagcagattatatcaacgaaccttatgaagaaatt
gttaaagaaaaagtatggccacctagtggagatcattatattaaacatatgtattatcac
gcatatgcacatgaaaatgctgcgtatactatagctgcaatggcaccttgtccttatgta
tatgaagtagtagctaaaatggcattagatgatcaaaatctaaatagagattcagtaaca
tcgaaatggtttgatttctatagcacagaaatgcgaccattaatcgaagtatttgacaat
ttattagatgaattaacagcaaattgtacagaacaagagaaaaaagatattaaagaaagt
ttcttacaaagtactatacatgaacgtaatttctttaatatggcttatattaatgaacag
tggaacttcggaggcgacaaaaatgcataa

DBGET integrated database retrieval system