KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_01469Help
Entry
ShL2_01469        CDS       T03837                                 

Gene name
gLY1
Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00260  Glycine, serine and threonine metabolism
shh01100  Metabolic pathways
shh01110  Biosynthesis of secondary metabolites
shh01120  Microbial metabolism in diverse environments
shh01130  Biosynthesis of antibiotics
shh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ShL2_01469 (gLY1)
Enzymes [BR:shh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ShL2_01469 (gLY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Nt_Gln_amidase Met_gamma_lyase Pyridoxal_deC SepSecS
Motif
Other DBs
NCBI-ProteinID: AKC76330
UniProt: A0A2A1KCY3
Position
1558653..1559678
Genome map
AA seq 341 aa AA seqDB search
MISFENDYLEGAHENVLQRLFDTNLIQASGYGDDQFSKQAAEQIKSVINCPEATVRFLVG
GTQTNQVVINSVLEPYEGVISADTGHVAVHEGGAIEFSGHKVLTVPSHEGKIRPKEVNAY
LDTFYNDFKREHMVFPGMVYISHPTEYGTLYSKKELKNLADVCKEHNVPLFMDGARLGYG
LMSDQSDLTFEDIAKYCDIFYIGGTKIGALCGEAIVFTKNNEPKHFTTRIKQHGALLAKG
RLVGVQFLELFTNNLYLDISRHAINMANKMKKGFLEKGYQLYFDSPTNQQFFVLSEEKIK
ALKQKVKFAIWEKYDDNHRVVRFATSWATTEENVDKLLELI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttttgaaaatgactaccttgaaggtgcacatgaaaacgtattacaacgatta
tttgataccaatttaatccaggcctctggctatggtgatgatcaattttcaaagcaagca
gcagaacaaataaaatctgttatcaattgtccagaagcgactgtacgattcttagttggt
ggtacgcaaaccaatcaagttgttattaattcggtactagagccatatgaaggtgtgatt
tcagctgacactggtcacgtagctgtacatgagggcggtgctattgaatttagtggtcat
aaagttttaactgtcccatctcacgaaggtaaaattagaccaaaagaagttaatgcatat
ctagatacgttttacaatgattttaaacgtgaacacatggtctttccaggaatggtttat
atttcacaccctacagaatacggtactttgtatagtaaaaaagaattgaagaatcttgct
gacgtgtgtaaagaacataatgtacctttatttatggatggtgcgcgtttaggctatggt
ttaatgagtgatcaaagtgatttaacatttgaagacattgctaaatactgtgatatcttt
tatataggtggtactaaaataggtgcgttatgtggtgaagccatcgtattcactaaaaat
aatgagccaaaacactttaccactcgaatcaaacaacatggtgctttacttgctaaaggt
cgtttagtaggtgtacaatttctggaattattcactaataatttatatttagatattagc
cgtcatgccattaatatggctaataaaatgaaaaaaggatttcttgaaaaaggctatcaa
ctttactttgattcacctactaatcaacaattttttgtacttagtgaagaaaagattaaa
gcgttgaaacaaaaagtaaagttcgcgatttgggagaaatatgatgataatcatcgtgtt
gttagatttgcgacaagttgggctactaccgaagaaaatgtagataagttattagagtta
atttaa

DBGET integrated database retrieval system