KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_01538Help
Entry
ShL2_01538        CDS       T03837                                 

Gene name
bsaA
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
shh00480  Glutathione metabolism
shh00590  Arachidonic acid metabolism
shh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ShL2_01538 (bsaA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ShL2_01538 (bsaA)
Enzymes [BR:shh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ShL2_01538 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AKC76398
UniProt: A0A2S6E0S2
Position
1606345..1606821
Genome map
AA seq 158 aa AA seqDB search
MENIYDFVVQKSNGEDYKLEEYKGKVMLIVNTASECGFTPQFEGLQALYEKYKDQGFVIL
GFPCNQFGGQEPGSGAEANQNCKINYGVTFPIHEKVDVKGENQHPLFRYLTDAAKGMLSE
KIKWNFTKFLVDRDGNVVSRFSPQKKPAQIEKDIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatatatgattttgttgtacaaaagtccaatggtgaagattataaattagaa
gaatacaaaggcaaagtaatgctaatcgttaatactgctagtgaatgtggtttcacgcca
caatttgaaggcttacaagcattgtatgaaaaatacaaagaccaaggttttgtgatatta
ggttttccatgtaatcaatttggtggccaagaacctggttcaggtgcagaagctaatcaa
aactgtaaaattaattacggtgtgactttccctatccatgaaaaagtagatgtcaaaggt
gaaaatcaacatcctttattccgctacttaactgatgcagctaaaggaatgttaagtgaa
aaaatcaaatggaacttcactaaattcttagttgatcgtgatggtaacgttgtaagtcgt
ttctcacctcaaaagaaaccagctcaaatcgaaaaagatattgaaaaattattatag

DBGET integrated database retrieval system