KEGG   Slackia heliotrinireducens: Shel_11850Help
Entry
Shel_11850        CDS       T00981                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00240  Pyrimidine metabolism
shi00250  Alanine, aspartate and glutamate metabolism
shi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Shel_11850
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shel_11850
Enzymes [BR:shi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Shel_11850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ACV22217
UniProt: C7N5N2
Position
1368447..1369391
Genome map
AA seq 314 aa AA seqDB search
MAFDHKHLIDITEYSDTDIMTILETAKAFSSVNERKIKKVPTLKGITVVNMFNEPSTRTR
SSFELAEKRLSADCLNFGGSSTSSVKGESLIDTVETLNAYKIDAVVVRDKHAGAPYIVSQ
HTPASVIDAGDGKHQHPTQALLDLYTIWEHKQDFKGLKVAIVGDVGHSRVCGSLVPALKI
MGAEVTLVAPGTLMPPRPEVLGADHATPYLDEVLPDMDVVYMLRVQRERLEGAPFPSLTE
YHELFGLTKKREKLMKPDAIICHPGPINRGVEFDSYMADHPQRSVILEQVYAGICVRMAV
LYLLLGGADNGLNS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaccataagcaccttatcgatatcacagagtattccgataccgatatcatg
actatcctggagaccgccaaagcgttctcgtccgtgaacgagcgcaagatcaagaaggtc
cccacgctcaagggcatcaccgtcgtgaacatgttcaacgagccctcgacccgcacccgc
agctccttcgagctggctgaaaagcgcctgtccgccgactgtctgaacttcggcggctcg
tccacctcctcggtcaagggcgaaagcctcatcgacacggtggaaaccctgaacgcatac
aagatcgacgccgtggtcgtgcgcgacaagcacgcaggcgccccctacatcgtctcgcag
cacaccccggcttcggtcatcgacgccggcgacggcaagcaccagcatcccacccaggcg
ctgctggacctctacaccatctgggagcacaagcaggacttcaagggcctgaaggtggcc
atcgtcggcgacgtggggcattcccgcgtctgcggctctctggtcccggccctcaagatc
atgggtgccgaagtcaccttggtcgcaccgggcaccctcatgccgccgcgccccgaggtg
ctgggcgccgaccacgccacgccctatctggacgaggtgctgcccgacatggacgtcgtg
tacatgctgcgcgtccagcgcgaacgcctcgaaggcgcgccgttcccgagcctgacggaa
taccacgagctcttcggcctgaccaagaagcgcgagaagctcatgaagcccgacgccatc
atctgccaccctggccccatcaaccgcggcgtcgaattcgacagctacatggccgaccat
ccgcagcgttcggtcatcctcgaacaggtctatgcaggcatctgcgtccgcatggccgtc
ctgtatctgcttttgggaggtgctgataatggccttaattcttaa

DBGET integrated database retrieval system