KEGG   Slackia heliotrinireducens: Shel_13470Help
Entry
Shel_13470        CDS       T00981                                 

Definition
(GenBank) glutamyl-or glutaminyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00860  Porphyrin and chlorophyll metabolism
shi00970  Aminoacyl-tRNA biosynthesis
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01120  Microbial metabolism in diverse environments
Module
shi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:shi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shel_13470
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Shel_13470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shi01007]
    Shel_13470
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:shi03016]
    Shel_13470
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:shi02048]
    Shel_13470
Enzymes [BR:shi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Shel_13470
Amino acid related enzymes [BR:shi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Shel_13470
Transfer RNA biogenesis [BR:shi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Shel_13470
 Prokaryotic Type
   Other AARSs
    Shel_13470
Prokaryotic defense system [BR:shi02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Shel_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ACV22370
UniProt: C7N635
Position
1541563..1542516
Genome map
AA seq 317 aa AA seqDB search
MPVETHTALENAPVKGRFAPSPTGRMHAGNIYAALCAWLVAKSQGGSIVLRIEDLDRERS
KHEYIDAVQRDFEFLGLTWDEGPYFQSGRDEAYQQAFDTLVEKGLVYPCYCTRADLHAAS
APHRGEKLIYAGTCRNLTAAQRAQRELSRKPAQRLIVPDEVYALDDLVQGHYEQNLAHDC
GDFLIRRSDGAFAYQLAVVVDDAAQGVNSVVRGMDLLCSTPQQIYLQRILGLSEAQYAHV
PLLVAERNRRLSKRDHDASIDCLLERFKSPEAIVGHIAGITGLAPNCDPATPEQLLETFT
IGRLSTCFDDLVQIQWR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtcgaaacgcataccgctttagaaaacgcccctgtgaaggggcgtttcgctccg
tcgcctacgggtcgcatgcacgccggcaacatctacgctgccctgtgcgcctggctggtc
gcgaaatcgcaaggcggatccatcgtgctgcgcatcgaggatctggacagggaacgctcc
aagcatgaatacatcgatgcggtgcagcgcgattttgaattcctagggctgacctgggac
gaagggccgtatttccagagcgggcgcgacgaggcgtaccagcaggccttcgacacgctt
gttgagaaaggcctggtctacccatgctactgcaccagggccgatttgcatgccgcatcg
gctccgcacaggggagagaagctgatctatgccggcacctgccgaaacctgacggccgca
cagcgtgcgcaacgggagctttcccgaaaacctgcccagcgcctcatcgtgcccgacgag
gtgtacgcattggacgatctggtccaagggcattacgaacagaacctggcgcacgactgc
ggagacttcctcatccgcaggtcggacggcgccttcgcctatcagctggccgttgtggtc
gacgacgccgcccaaggcgtgaactccgtggttcgtgggatggacctgctgtgctcgacg
ccccagcagatctacctgcagcggattctggggctttctgaggcccagtatgcccatgtg
ccgctccttgtagcagaaaggaaccgtcgcctgtccaagcgtgaccatgacgcgtcaatc
gactgcttgctcgagcgtttcaagagtccggaagctatcgttgggcatatcgcgggcatt
acagggcttgcgcccaactgcgatcccgccacgccggaacagcttctggagacgttcacg
atcggccggctctcaacctgcttcgacgatcttgtccaaatccagtggcgctag

DBGET integrated database retrieval system