KEGG   Slackia heliotrinireducens: Shel_17070Help
Entry
Shel_17070        CDS       T00981                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00500  Starch and sucrose metabolism
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shel_17070
Enzymes [BR:shi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Shel_17070
Exosome [BR:shi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shel_17070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Alpha-amylase_C Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACV22726
UniProt: C7N741
Position
complement(1925888..1927852)
Genome map
AA seq 654 aa AA seqDB search
MDQPSRTNLNLPDADLYLFGHGDARRAYLLFGCHELPRESESDVRTFRFVLWAPHARSVS
LVGSFNQWDQAATPMEQVSEGIWCCVVEGLENGDPYKYAIEGADGTVQLKADPFAFHAEN
GLSTASKVWTLDGYDWHDADWMDARAASDPLHGPMSIYELHLGSWRVGEQETFPNYRIVA
DQLVEYCQQMGYTHVELMPLTEFPLPASWGYQATGYYAVSSRYGTPQDFMYMVDTLHAAG
IGVILDWVPAHFPKDAFALARFDGTPLFEYADPRKGEHAEWGTLVFDYGKPQVVSFLVSS
AMFFLDVYHIDGIRVDAVTSMLYLDYARTEWVPNIHGGNINLEAVDFIRKLNTAVRETYP
GAVTIAEESTSYPKVTAPVEYDGLGFTFKWDMGFMHDMLEYCSMDPLFRRDHHDKLTFGM
VYAFSEHFVLAFSHDEVVHGKKSMVDKMFGDYLQKFANLRVLMGWQFARPGKKLTFMGSE
FGQFIEWDFAKQLDWFMLKYPIHNGLHLYSAALNKMYAAHPALWQIDDCWDGFQWANVDD
RDESAVACLRQARDGSPDVLCCCNFTPNAVEGFTVGLPTCGELHLLLDSDIELYGGTDCG
AAVIEAPAEEPFEGHPCSAKLKLPPMSAVFFEFVRSNPPKETEDALPGGPETKE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccgagccgtaccaatctgaatctgccggatgccgacttatatttgttcggc
catggggatgcgcgtcgggcatacctgctgttcggttgccacgagctgcctcgcgaaagc
gaatccgacgtccgcacgttccggttcgtgctttgggcccctcatgcccggtcggtaagc
cttgtgggctccttcaaccaatgggaccaggcggcaacgcccatggagcaggtgagcgaa
ggcatctggtgctgcgtggtggaaggccttgagaacggcgacccttacaaatacgccatc
gaaggtgccgacggcaccgtgcagctgaaagccgaccccttcgcgtttcatgcggaaaac
ggcctgtccaccgcttccaaggtgtggacgctggacggctacgactggcatgatgccgac
tggatggatgcccgagccgcatccgacccgctgcacggacccatgtccatctacgagctg
cacctgggttcgtggcgcgtgggcgagcaggaaaccttccccaactaccgtattgtggct
gaccaactggtggaatactgccagcagatgggctatacccatgtggagctcatgccgctg
acggaattcccgctgccggcatcttggggctaccaggccaccggctactatgcggtgtcg
tcgcgatacggcacgccccaggatttcatgtacatggtggacacgctgcacgccgcaggc
atcggcgtcatcctggactgggtaccggcgcacttcccgaaggacgccttcgccttggct
cgcttcgacggcacgccgcttttcgaatacgccgacccgcgcaagggcgagcatgccgaa
tggggcacgctcgtgtttgattacggaaagccccaggtggtaagctttctggtgtcgtcg
gccatgttctttttggacgtctaccacatagacggtatccgtgtggacgccgtcacgtcc
atgctgtacctggattacgcccgcaccgaatgggtgcccaacatccacggcggcaacatc
aacctggaggccgtcgatttcattcgcaagctcaacacggccgttcgggaaacctatccc
ggcgcggtgaccatcgccgaggaatccacatcgtatcccaaggtcacagccccggtggaa
tacgacggcctgggattcaccttcaaatgggacatgggtttcatgcacgacatgctggag
tactgctccatggacccgctgttccgccgcgaccaccacgacaagctcaccttcggcatg
gtgtacgccttctccgagcatttcgtgctggccttcagccatgacgaggtggtgcacggc
aagaaatccatggtggacaagatgttcggcgactacctgcagaaattcgcgaacctgagg
gtgctcatgggttggcagttcgcccgccccggcaagaagctcaccttcatgggttcggag
ttcggccagttcatcgagtgggatttcgccaagcagctggactggttcatgctgaagtac
cccatacacaacgggcttcacctgtacagcgcagccctgaacaagatgtacgcggcccat
cccgccctgtggcagatcgacgactgctgggacgggttccaatgggccaacgtggacgac
cgggacgaaagcgcggtggcatgcctgcgccaggctcgtgacggatcgcccgacgtcctg
tgctgctgcaacttcacgcccaacgcggtcgaaggattcacggtcgggcttccgacctgc
ggcgagctgcatctgctgctggacagcgacatcgagctgtacggcggcaccgattgcggc
gcggccgtgatcgaggcgcctgccgaggagcctttcgaagggcacccctgcagcgccaaa
ctgaaactgccgcccatgtcggccgtgttcttcgagttcgtgcggagtaatcctcccaag
gagaccgaggacgcgttgccaggcggccccgaaacgaaagaatag

DBGET integrated database retrieval system