KEGG   Slackia heliotrinireducens: Shel_19450Help
Entry
Shel_19450        CDS       T00981                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:shi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Shel_19450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shi01007]
    Shel_19450
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:shi03016]
    Shel_19450
Enzymes [BR:shi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Shel_19450
Amino acid related enzymes [BR:shi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Shel_19450
Transfer RNA biogenesis [BR:shi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Shel_19450
 Prokaryotic type
    Shel_19450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ACV22961
UniProt: C7N7S6
Position
complement(2178136..2179632)
Genome map
AA seq 498 aa AA seqDB search
MIRLYDTQAHQKLDFVPNQEGVIHMYVCGPTVYNYIHIGNARTFISFDIIRRYLMWRGFD
VTFVQNVTDVDDKIIKKANEEGRSAAEVATEYTDAFIEDMRAMGVLDPDVRPKATEEIDS
MIELVSTLIERGHAYEVEGDVYFSVRSFPEYGKLSHRNIDELEGGHRELRADGQGLEDRK
RDPLDFAVWKAAKPGEPSWPSPWGEGRPGWHIECSAMSRKYLGLPLDIHGGGADLAFPHH
ENEIAQSEAAYGVAFSNHWMHGGMLNINGEKMSKSLGNFLLLRDILKTVEPSVLRMFMAR
AHYRSPLDFNEERVAEAAASLERIVNFVERMDWLVSNPDGNAQPLSGDYSFEQGIEAVRA
GFVEAMDDDFNTAGALGCIFTFVNDANAALGNATLNAEDASRIKAVRDTVVDLMGVFGIS
VEKAAGEEYPAEVIDLARDVAGYAGSDAAEAVEALLAARAQARKEKNWAVADGVRNGLND
LGFVIEDTPQGAKVSYKQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgataaggctgtacgatacccaagcgcaccagaagcttgacttcgtccccaatcaggag
ggcgtcatccatatgtacgtatgcggtcccaccgtgtacaactatatccacatcggcaac
gcccgtacgttcatcagcttcgacatcatccgccgctacctcatgtggcgcggcttcgac
gtcacgttcgtgcagaacgtgaccgacgtcgacgacaagatcatcaagaaagccaacgaa
gagggccgaagcgccgcggaggtggcaacggaatacaccgatgccttcatcgaggacatg
cgtgccatgggcgtgctcgatccagacgtgcgcccgaaagccaccgaagaaatcgattcc
atgatcgagctggtcagcacgctgatcgagcgcggccacgcctacgaggtggaaggcgac
gtgtacttcagcgtccgctccttcccggaatacggcaaactgtcccatcgcaacatcgat
gagctcgaaggcggccaccgcgaactgcgcgccgacggacagggtctggaggaccgcaag
cgcgacccgctggacttcgccgtatggaaggcggccaagcccggcgagcccagctggccg
tcgccttggggcgaaggccgtcctggctggcacatcgaatgctcggccatgagccgtaaa
tacctggggctgcccctggacatccacggcggcggcgccgatctggccttcccgcaccat
gagaacgaaatcgcccagtctgaagcggcatacggcgtggccttctccaaccattggatg
catggcggcatgctcaacatcaacggtgagaagatgtccaagagtctgggcaacttcctg
ctgctgcgcgatatcctgaaaaccgtggagccgtcggtgctccgcatgttcatggcgcgc
gcccattaccgcagccccttggacttcaacgaggagcgtgtggccgaagcagcggcatcg
ctggagcgcatcgtcaacttcgtggagcgcatggattggctcgtgtccaaccccgacggc
aatgcccagccgctgtcaggcgactactctttcgagcagggcatcgaggcggtccgtgcg
ggcttcgtcgaggctatggacgacgacttcaatacggcgggcgcgctcgggtgcatcttc
accttcgtgaacgacgccaacgccgccttgggcaacgccacccttaacgccgaggatgca
tcccgcatcaaggcggtccgcgatacggtcgtggacctcatgggcgttttcggaatctcg
gtcgagaaggccgcgggtgaggaatatcccgccgaggtcatcgacctggcccgcgatgtg
gcgggttatgcaggctctgacgccgccgaggcggtggaggcgctgcttgccgcacgtgcc
caggcccgcaaggaaaagaactgggctgtggccgacggcgttcgcaacggcctgaacgac
ctgggcttcgttatcgaagatacgccgcagggcgccaaggtctcctacaagcagtaa

DBGET integrated database retrieval system