KEGG   Slackia heliotrinireducens: Shel_23580Help
Entry
Shel_23580        CDS       T00981                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
shi  Slackia heliotrinireducens
Pathway
shi00900  Terpenoid backbone biosynthesis
shi01100  Metabolic pathways
shi01110  Biosynthesis of secondary metabolites
shi01130  Biosynthesis of antibiotics
Module
shi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:shi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shel_23580
Enzymes [BR:shi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Shel_23580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh DUF1805 ZT_dimer
Motif
Other DBs
NCBI-ProteinID: ACV23367
UniProt: C7N1S6
Position
complement(2612158..2613336)
Genome map
AA seq 392 aa AA seqDB search
MTAKRVAVLGSTGSIGTQTLDVAWRHPDKIQIVALAANHSVETVVEQAHEFRVRNVAFGD
ETMRDHAMLANVHEGVSVGFGQQGILDLVHSDDVDCVVNALVGAAGMRASYETLAAGKQL
ALANKESLVVAGDLIMPLAKQLDEAAGHPWALMPIDSEHGAIYQCLLGERHEEVAALWVT
ASGGPFRGRTRDQLSGMTAKEALAHPTWKMGPKITIDSSTLMNKGLEVIEAHHLFDMPYD
RIKVVVQPQSAIHSMVEYSDGSVKAHLGTTDMRIPIQFALSYPDRWDAPVEPMDFTKLGK
LEFYPVDEETFRCFALAKRAGATGGTLPCVMNAANEVAVAAFLADRCGYLDIDACVEHAM
DAHEVQAVESLDQLAEIDAWARAVSREYLGVA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaaacgtgtcgccgtcttgggctccacgggctccatcggcacccagacgctt
gatgtagcatggcgtcatcctgacaagattcagatcgtggcgctggccgccaaccacagc
gtcgagacggtggtggagcaggcccacgaattccgcgtgcgcaacgtcgccttcggcgac
gagaccatgcgcgaccatgccatgctggcgaacgtccacgaaggcgtttcggtggggttc
gggcagcaggggattttggacctggtgcattcggacgacgtggactgcgtcgtaaacgcg
ctggtcggcgccgccggcatgcgcgcgtcctacgagacgctggcggcgggcaagcagctt
gcccttgccaacaaggagagcctggtggtggcgggcgacctcatcatgccgttggccaag
cagctggacgaggctgcggggcacccgtgggccctcatgcccatcgattcggagcacggc
gccatctaccaatgcctgctgggcgagcgacacgaggaagtggcggcgctgtgggtgacc
gcgtccggcggaccgttccgcggtcgcacgcgcgatcagctttcaggcatgaccgccaaa
gaggcgttggcgcatcccacgtggaagatgggtccgaagatcaccatcgattcgtccacc
ctcatgaacaagggtctggaggtcatcgaggcgcaccacctgttcgacatgccgtacgac
cgcatcaaggtggtggtgcagccgcaaagcgcgatccactccatggtcgaatactccgac
ggctcggtgaaggcgcatctgggaaccaccgacatgcgcattcccatccagttcgcactg
tcgtatcctgaccgctgggacgccccggtcgagcccatggacttcaccaagctcggtaag
ctggagttctatcccgtggacgaggagaccttccgctgcttcgcgttggcgaaacgcgcg
ggcgctacgggcggcacgctgccctgcgtgatgaatgcggccaacgaggttgccgtggct
gcgtttctggccgaccggtgcgggtatctggatatcgacgcctgcgtggagcacgccatg
gacgcccatgaggtgcaggcggtcgaaagccttgaccagcttgcggaaatcgacgcctgg
gcccgcgcggtctcgcgtgagtacttgggggtcgcttga

DBGET integrated database retrieval system