KEGG   Spiroplasma helicoides: SHELI_v1c05420Help
Entry
SHELI_v1c05420    CDS       T04620                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
shj  Spiroplasma helicoides
Pathway
shj00051  Fructose and mannose metabolism
shj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SHELI_v1c05420 (mtlD)
Enzymes [BR:shj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SHELI_v1c05420 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh DUF3884
Motif
Other DBs
NCBI-ProteinID: AOG60493
UniProt: A0A1B3SKP7
Position
complement(620564..621688)
Genome map
AA seq 374 aa AA seqDB search
MKVLHFGAGNIGRGFIAPILFNSKQIKELYFTDNNIDLISKLKETKEYNVIELDEKEKIV
KVSGYNAVHSNDIDKELKLEEFDVLTTSIGSVNLKYIKDQVIKFIKAKESIKKPLIIMCC
ENGEKISSLFEKEVIESYKFDKKLIKFVDVMVDRIVPNEVSSDLSIKVEPYSSWVADERN
WPSELEKITTIKYTENIDAEICKKVWMLNGGHASIAWKEWQLSKFKNKFINETLNNEIDN
RLIIFLKRYLTEISNVVEFQFNYNREALDDFIDSVVSRFTNVHIKDEFDRVARNTLKKLQ
LDERILKPFQIAITNNIGCGYIKETIINALSYNNLDDPDCKLLEDLRRSHQDYKEFIASV
IKDIDSETLNQIIN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtactacattttggagcaggaaatattggaagaggttttattgcccctattctt
ttcaacagtaaacaaattaaagaattatactttacagacaataatattgatttaataagt
aaattaaaagaaacaaaagaatataatgtaattgaattagatgaaaaagaaaaaatcgtt
aaagtaagtggttataatgcagttcattctaacgatatcgacaaagaattgaaattagaa
gaatttgatgttttaacaacttcaataggatcagtcaatttaaaatatattaaagatcaa
gttataaaatttatcaaagcaaaagaaagtattaaaaaacctttaataattatgtgttgt
gaaaacggagaaaaaatttcttcattatttgaaaaagaagttatagaatcatataaattt
gacaaaaaattaattaaatttgttgatgttatggttgatagaattgtacctaatgaagta
tcaagtgatttaagcatcaaagttgaaccctactcatcatgagtcgcagacgaaagaaac
tgacctagtgaacttgaaaaaattactacaatcaagtacacagaaaatattgatgctgaa
atttgtaaaaaagtatgaatgttaaatggaggtcatgcttcaatcgcttgaaaagaatga
caactttcaaaatttaaaaataaatttattaatgaaactttaaataatgaaatagataat
agactaattatatttttaaaaagatatcttacagaaatttcaaatgttgttgaatttcaa
tttaattataatagagaagcattagatgatttcattgattctgtagtaagtagatttaca
aatgttcatataaaagatgaatttgatagagttgcaagaaatacccttaaaaagttacaa
cttgatgaaagaattttaaaaccatttcaaatagcaataactaacaacattggctgtgga
tatattaaagaaacaattataaacgccctttcatacaataatttagatgatcctgattgt
aaattacttgaagatttaagaagatcacatcaagattataaagagtttatagcttcagtt
ataaaagatattgattctgaaacattaaaccaaatcataaattaa

DBGET integrated database retrieval system