KEGG   Shewanella halifaxensis: Shal_2592
Entry
Shal_2592         CDS       T00654                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
shl  Shewanella halifaxensis
Pathway
shl00620  Pyruvate metabolism
shl00640  Propanoate metabolism
shl00650  Butanoate metabolism
shl01100  Metabolic pathways
shl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shal_2592
   00640 Propanoate metabolism
    Shal_2592
   00650 Butanoate metabolism
    Shal_2592
Enzymes [BR:shl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Shal_2592
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABZ77148
UniProt: B0TKC9
Position
3144304..3146586
AA seq 760 aa
MTEKTEQFATAWEGFTAGDWKTEVNVRDFIQANYTPYEGDESFLAGATEATTELWDKVMV
GVKEENRTHAPVDFDTSRVSTITSHEAGYITKDLETIVGLQTEAPLKRAMLPNGGIRMVE
SSCAAYGRELDADVKYVFSELRKTHNQGVFDIYTPEIMRCRKSGVLTGLPDAYGRGRIIG
DYRRVALYGIDFLMADKFAQFTSLQSDFETGENLSYTMQLREEIAEQHKALGQMKKMAAS
YGFDISLPATNAKEAIQWTYFGYLAAVKSQNGAAMSLGRTSSFLDIFIERDLKNGTLTEQ
EAQEMVDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIAGMGLDGRTLVTKSSFRFLHT
LYNMGPSPEPNITVLWSEQLPLNFKKYAAKVSIDTSSIQYENDDLMRPDFESDDYAIACC
VSPMIVGKHMQFFGARANLAKTMLYAINGGVDEKLNAQIGPKSAPITDEVLNYDDVMARL
DTMMDWLATQYVSALNAIHFMHDKYSYEAALMALHDRDVRRTMACGIAGLSITADSLAAI
KYATVKPIRDENGIAVDFDIEGDYPKFGNNDPRVDDIATELVERFMAKIRAMKMYRDAIP
TQSILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDEKGAIASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDDDARKTNLAALMDGYFAHNDNREGGQHLNVNVMNREMLEDAI
VNPDKYPQLTIRVSGYAVRFNSLTPEQQQDVITRTFTKGL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaccgaaaaaactgaacagtttgcaaccgcgtgggaaggtttcaccgctggcgattgg
aaaactgaagtcaatgtgcgtgactttattcaagctaactacactccttatgaaggcgac
gagtctttccttgccggtgctactgaagcaacgaccgaactttgggacaaagttatggtt
ggcgttaaggaagagaaccgcactcacgctcctgtagattttgatacatctcgcgtatca
acaatcacttctcacgaagctggttacattactaaagatttagaaactatcgttggtctg
caaacagaagctccgcttaagcgcgctatgttgccaaacggtggtattcgtatggttgaa
agttcttgcgctgcatacggccgtgaactagacgctgacgtaaaatacgtattctcagag
ctacgtaagacacacaaccaaggtgtgtttgatatctacactccagaaatcatgcgttgt
cgtaagtctggcgtattgactggtttaccagatgcatacggccgtggtcgtatcattggt
gactaccgtcgtgttgcgctatacggtattgatttcctaatggcggacaagtttgctcag
ttcacttctcttcagtctgatttcgaaactggcgaaaacttgtcttacactatgcaactt
cgtgaagaaattgctgagcagcacaaagcactaggtcaaatgaagaagatggcagcaagc
tacggcttcgacatctctttacctgcgactaacgctaaagaagcgatccagtggacttac
ttcggctacctagctgcagttaagagccaaaacggtgcggctatgtctttaggtcgtact
tctagcttcctagatatcttcatcgaacgcgatcttaagaatggcacattgactgagcaa
gaagctcaagagatggttgaccatttcgtaatgaagctacgtatggttcgtttcctacgt
actccagaatacgatgagctattctctggcgacccaatctgggctacagagtctatcgct
ggtatgggtcttgacggccgtacactagtaactaagtcaagcttccgtttcttgcacact
ctatacaacatgggtcctagcccagagccaaacatcacggttctatggtcagagcaacta
ccgctaaacttcaagaagtacgcggctaaagtatctatcgatactagctctatccaatac
gaaaacgatgacctaatgcgtccagatttcgaatctgacgattacgctatcgcatgttgt
gtaagcccaatgatcgtgggtaagcacatgcagttcttcggcgcgcgtgcaaaccttgct
aagacaatgctttacgcaatcaacggtggtgttgacgagaaacttaacgctcaaatcggt
cctaagtctgcgccaattacagacgaagtattgaactacgatgacgttatggctcgttta
gacactatgatggactggcttgctacacaatatgtgtctgcactaaatgctatccacttc
atgcacgacaagtactcttatgaagcagctcttatggctcttcatgacagagacgtacgt
cgtactatggcatgtggtatcgcaggtctttctatcactgctgactcactagctgctatt
aagtacgcaacagttaagccaatccgtgatgaaaacggcattgctgttgacttcgacatc
gaaggcgactatccaaagttcggtaacaacgacccacgtgttgacgatattgctactgaa
ttagttgagcgtttcatggcgaagatccgtgctatgaagatgtaccgtgatgcgatccca
acacagtctatcttaaccattacttcaaacgtagtttatggtaagaagacaggtaacaca
ccagatggtcgccgcgctggtgcaccatttgctccaggtgctaacccaatgcacggtcgt
gatgagaaaggcgcaattgcatctttaacatctgtagctaagctaccatttgctcacgca
caagacggtatctcttacacattctctatcgtacctaacgcattaggtaaagatgatgat
gctcgtaagacaaacctagctgcgcttatggatggttacttcgcacacaacgataaccgt
gaaggtggtcaacacctgaacgttaacgtaatgaaccgtgaaatgcttgaagatgctatt
gttaacccagataagtatccacagttaacgatccgtgtttctggttacgcagtacgcttt
aactctctaacgcctgagcaacagcaagacgttattacccgtacctttactaaaggtctg
taa

DBGET integrated database retrieval system