KEGG   Shewanella halifaxensis: Shal_0016Help
Entry
Shal_0016         CDS       T00654                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
shl  Shewanella halifaxensis
Pathway
shl00071  Fatty acid degradation
shl00280  Valine, leucine and isoleucine degradation
shl00281  Geraniol degradation
shl00310  Lysine degradation
shl00362  Benzoate degradation
shl00380  Tryptophan metabolism
shl00410  beta-Alanine metabolism
shl00640  Propanoate metabolism
shl00650  Butanoate metabolism
shl00903  Limonene and pinene degradation
shl00930  Caprolactam degradation
shl01040  Biosynthesis of unsaturated fatty acids
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
shl01212  Fatty acid metabolism
Module
shl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shal_0016
   00650 Butanoate metabolism
    Shal_0016
  Lipid metabolism
   00071 Fatty acid degradation
    Shal_0016
   01040 Biosynthesis of unsaturated fatty acids
    Shal_0016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shal_0016
   00310 Lysine degradation
    Shal_0016
   00380 Tryptophan metabolism
    Shal_0016
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shal_0016
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shal_0016
   00281 Geraniol degradation
    Shal_0016
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shal_0016
   00930 Caprolactam degradation
    Shal_0016
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shal_0016
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shal_0016
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shal_0016
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Shal_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABZ74592
UniProt: B0TLB9
Position
complement(18833..20986)
Genome map
AA seq 717 aa AA seqDB search
MIYQSPTIEVELLEDNIAHLCFKAQGSVNKFDRETIDSLNAALDSIKQDTSIKALMLSSA
KDAFIVGADITEFLGLFAEEDAVLQSWLEQANVVFNKLEDLPFPTLSAINGFALGAGCET
ILATDFRIADTTARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITSGKDQRPDAALK
VGAIDAVVAPEQLRPAALRMLKDAMAEKLDWQTRRAKKLAPLTLPKLEAMMSFATAKGMV
FKIAGKHYPAPMAVISVIEQAAQCGRAEALQIEHQAFIKLAKTEVAQALIGIFLNDQLVK
GKAKKAGKLAKKVNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAAKLL
TAQVKRGRSTPAKMATVLNNITPALDYAPVKDTDIIVEAVVEHPKVKSMVLAEVEEHVSE
DAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSDETVASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGKDAIDVMFEAERFGQKNNKGFYQYSVDHRGKP
KKDLDPTSYELLQAEFGEQKAFESDEIIARTMIPMIIETVRCLEEGIIASPAEADMGLVY
GLGFPPFRGGVFRYLDTIGVANFVALADKYAHLGGLYQVTDTMRELAANNGSYYQQA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagccctacaattgaggttgagttactcgaagacaacatcgcgcatttg
tgcttcaaggcacaaggttcggttaataagttcgacagggaaaccatcgactcgttaaat
gctgcactcgacagcatcaaacaagacactagcatcaaggctctaatgctaagttcagcg
aaagacgctttcatcgttggtgccgatatcacagaattcctaggattgttcgccgaagag
gatgcagtcttacagtcttggctagagcaagccaacgttgtattcaacaaattagaagat
ctgcccttcccaactctttctgcaattaatggctttgcgctgggtgccggttgcgaaacc
attctagctaccgacttccgtatagcagacaccacagcccgtattggcctaccagaaact
aagctaggtattatcccgggctttggtggtaccgtgcgcctacctcgtgtaattggtgcc
gacaacgcacttgagtggatcacatcaggcaaagaccagcgtccagacgccgcacttaaa
gttggtgccatcgatgcagttgttgctccagagcaacttagacccgcggcattaagaatg
ctcaaagacgccatggcagaaaaacttgattggcagacccgccgcgctaagaagctggca
ccgcttacgctaccaaaactcgaagccatgatgtctttcgcaaccgcaaaaggtatggtc
tttaagattgcaggtaaacactacccagcaccaatggctgtgattagcgttatcgagcaa
gccgcgcagtgcggccgcgctgaagcactacaaatagaacatcaagcatttataaagctt
gccaagacagaagtcgcacaggcactgattggtatcttccttaatgaccagctcgtaaaa
ggcaaagccaagaaagcaggcaagctggctaagaaggtaaactcggcagcggtactcggc
gccggcatcatgggcggcggtatcgcatatcaaagtgccagcaagggcacgccgattgtg
atgaaagatattgcccaacccgcactcgatttaggtttaggtgaagccgctaagctatta
actgcacaagttaaacgcggacgctcaacaccagccaagatggctacggtgctgaataac
atcactccagcactcgattacgctccagtaaaagatactgatatcatcgttgaagcggtt
gtcgagcatccaaaagtaaaatctatggtgctggcagaggttgaagagcatgtcagtgaa
gatgccattatcacttcaaacacatcgactatatcaattaacctactagccaagagcctt
aaaaagcctgagcgcttctgtggtatgcacttcttcaacccggtacacaagatgccgcta
gtcgaagtcattcgtggtgaaaacagctctgacgaaacggttgcctcagtagtggcttac
gccagcaaaatgggcaagacgcctatagtggttaatgactgcccaggcttctttgtaaac
cgagtactcttcccgtactttgccggctttagtggcctacttgccgatggtgctgatttt
gccgctatcgataaagtgatggagaagcaatttggttggccaatgggccctgcttacctt
cttgatgttgtaggcctagatactggtcatcatgcacaagcagttatggctgaaggcttc
cctgaccgcatgggtaagtcaggtaaagatgctatcgatgttatgttcgaagccgagcgc
ttcggccagaaaaacaataaaggtttctatcagtattcggttgaccatcgcggcaagcca
aagaaagatttagatccaaccagctatgaattactgcaagctgagtttggtgagcaaaaa
gcatttgaatcagatgagatcatcgctcgcactatgatccctatgattatcgagacagtt
cgctgccttgaagaaggaattatcgcttcgcctgctgaagcggatatgggcttagtttac
ggccttggcttcccaccatttagaggcggtgtattccgttacctagataccataggtgtc
gctaactttgttgcactagcagacaaatacgcacacttaggtggtctataccaagtaacc
gacactatgcgtgaacttgccgccaacaatggcagctactaccagcaggcttaa

DBGET integrated database retrieval system