KEGG   Shewanella halifaxensis: Shal_0459Help
Entry
Shal_0459         CDS       T00654                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
shl  Shewanella halifaxensis
Brite
KEGG Orthology (KO) [BR:shl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shl03036]
    Shal_0459
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shl04812]
    Shal_0459
   02048 Prokaryotic Defense System [BR:shl02048]
    Shal_0459
Chromosome and associated proteins [BR:shl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Shal_0459
Cytoskeleton proteins [BR:shl04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   Shal_0459
Prokaryotic defense system [BR:shl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Shal_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C Tubulin_2 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABZ75034
UniProt: B0TQP1
Position
538958..540145
Genome map
AA seq 395 aa AA seqDB search
MFEIMDSHSDEAVIKVIGVGGGGGNAVEHMVKHNIEGVEFVATNTDAQALRKSAASTTIQ
LGRDVTKGLGAGANPEIGRLAAEEDRENIRNAIKGSDMIFIAAGMGGGTGTGAAPVVAEI
AREEGILTVAVVTKPFPFEGKKRMAYADQGIELLAKHVDSLITIPNEKLLKVLGRGTSLL
DAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMGNAMMGTGVASGEDRAEEA
AEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGNHVKAYASDNATVVVGAVID
PEMSDELRVTVVATGIGAEKKPDIQLVSKPAPRPEPIVPAEPRVESFAAEDAIAPTMSHG
NTAAATQPQVATPVAEKKNELDYLDIPAFLRKQAD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagatcatggatagtcattcagacgaagcggtgattaaggtcatcggtgtcggt
ggcggtggcggtaacgctgtcgagcatatggttaaacacaacatcgaaggtgttgagttt
gtggcaacaaatactgacgcacaagcgctgcgtaagtctgctgcatcaaccacaattcaa
ttaggtcgcgacgtaactaaaggtttaggggcaggcgcaaaccctgaaatcggtcgtttg
gcggcagaagaagacagagaaaacattcgtaatgcgattaagggatcggacatgatcttt
atcgcagcgggtatgggtggtggtaccggtactggtgctgcaccagtggttgcagagatt
gcacgtgaagaaggtattcttaccgttgctgtcgtgactaagcctttcccattcgaaggc
aagaagcgtatggcctacgcggatcaaggtattgagctgcttgctaagcatgtggactcg
ctaattacgattccaaacgaaaagttacttaaagtgttaggtcgtggcacctctttgtta
gatgcgttcgccgcagctaacaacgtactacttggcgccgttcaaggtattgcagagcta
attactcgccctggtttgattaacgtcgacttcgccgacgtgaaaacggttatgtcagaa
atgggtaatgccatgatgggcacaggcgttgcgagcggtgaagaccgagccgaagaagcg
gcagaggcagctgttgccagtccactactagaagatatcgatcttgctggcgctcgcggt
gttcttgtgaatatcactgctggtatggatatgagcatcgaagagttcgagactgtgggt
aaccacgttaaggcttatgcatctgacaacgcaacagtggttgtgggtgcggtaatcgat
ccagagatgtcagatgagctacgtgtaacggttgttgctacgggtattggcgctgaaaag
aagccagatatccagcttgtctctaagccagctccacgtccagaaccaattgttccggct
gaacctcgcgtagagagctttgctgctgaagatgcgattgcgcctactatgtcacacggt
aatactgcagcggcaactcagccacaagtcgcaacgccagtggccgagaaaaagaacgaa
cttgactacttagatattccagcgtttttgcgtaagcaagctgattaa

DBGET integrated database retrieval system