KEGG   Shewanella halifaxensis: Shal_0914Help
Entry
Shal_0914         CDS       T00654                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
shl  Shewanella halifaxensis
Brite
KEGG Orthology (KO) [BR:shl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Shal_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 LTD
Motif
Other DBs
NCBI-ProteinID: ABZ75489
UniProt: B0TV51
Position
complement(1133397..1133777)
Genome map
AA seq 126 aa AA seqDB search
MSQLTSSVRVDVKTEYIETQSSPDEDKYLFSYTITIHNLGSDDVTLKRRHWCITDSNGRK
SEVHGTGVVGETPTIKPNSSYKYTSGTVLETPLGVMEGSYTMVDSNGDEFKAPISAFRLS
IPGLLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattaacatcgtctgttagagtcgacgtaaaaacagagtatattgaaacccaa
tcctctccagatgaagataaatatctatttagttacacgattaccatccataatctcggt
tctgatgatgtgacactaaaacgtcgccattggtgtattaccgactcaaatgggcgaaaa
agtgaagttcacggcacgggcgtagtaggcgaaaccccgacaatcaaacccaatagctca
tataaatataccagtggcactgtattagaaaccccactcggggtgatggaaggcagctat
accatggtcgacagcaatggcgatgagtttaaagccccaatatccgcctttcgtttatca
attcctggtttacttcattaa

DBGET integrated database retrieval system