KEGG   Shewanella halifaxensis: Shal_1021Help
Entry
Shal_1021         CDS       T00654                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
shl  Shewanella halifaxensis
Pathway
shl00860  Porphyrin and chlorophyll metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
Module
shl_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
shl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shal_1021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shl01007]
    Shal_1021
Enzymes [BR:shl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Shal_1021
Amino acid related enzymes [BR:shl01007]
 Aminotransferase (transaminase)
  Class III
   Shal_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABZ75595
UniProt: B0TIQ0
Position
complement(1252662..1253951)
Genome map
AA seq 429 aa AA seqDB search
MTRSDELFEQAKKTIPGGVNSPVRAFSGVGGSPRFIEKADGAYIFDADGKKYIDYVGSWG
PMILGHNHPKIREAVLAAVENGLSFGAPTELEITMAEKVIEMVPSIEQVRMVSSGTEATM
SAIRLARGFTNRDKILKFEGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAT
YNDLDSVKAIFEQYPEEISCIIIEPVAGNMNCIPPIDGFLQGLRAICDQYGALMIIDEVM
TGFRVSKSGAQGHYGVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFIAPTGPVYQAGTLSG
NPIAMSAGLAQMEALCEEGVYEQLAAKTQYIAEGFKAAANKHGIPMAINYVGGMFGFFFT
DEATVTNFAQVTKCDTALFAEFYHLMLDEGVYLAPSAYEAGFLSLAHGEEELEATLAAAD
RVFAKLAKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttccgacgaactatttgaacaagctaaaaaaaccattcctggcggcgtaaac
tctccagtccgtgcattttcaggtgtgggtggctctccacgctttatcgaaaaagctgat
ggcgcttatatctttgacgccgatggtaaaaaatatatcgactatgtaggttcttggggc
ccaatgatcttaggccacaaccacccaaaaattcgcgaagcggtattagctgctgttgaa
aacggcctatctttcggtgcaccaactgaacttgaaatcactatggctgaaaaagtcatc
gagatggtgccttcaatagagcaagttcgtatggtgagttcagggactgaagccaccatg
agtgcgattcgtttagcacgcggttttactaaccgtgacaaaatccttaagtttgaaggt
tgctaccacggccacgcagactgcttgttagttaaagcaggttctggcgcactaacattg
ggtcagccaagctctccaggtattcctgaagactttgcaaagcacaccctaactgctact
tacaacgatctagattcagttaaggctatcttcgagcaatacccagaagagatctcttgt
atcatcatcgagccagttgctggcaacatgaactgtatcccgccaatcgacggtttctta
cagggtctacgcgctatctgtgatcagtacggcgcactgatgattatcgacgaagtgatg
acggggttccgcgtatctaagagcggtgcacaaggtcactacggcgtcacgccagatctt
acgacgctaggtaaagttatcggcggcggcatgcctgtgggtgctttcggtggtcgtaaa
gatgtgatgcagtttatcgcaccaacaggcccagtttaccaagcgggtacgctgtctggt
aacccaattgcgatgtcggcaggccttgcacagatggaagcgctttgtgaagaaggcgtt
tacgagcaactagcggctaagactcagtatattgcagaaggttttaaagctgcggcaaac
aagcatggcattccaatggcaatcaactacgttggtggcatgtttggtttcttcttcaca
gacgaagcgactgtaaccaactttgcgcaagtcactaagtgtgacactgcactgtttgct
gagttctaccacctaatgctagatgagggtgtttacctagcacctagcgcttatgaagca
ggtttcctatcacttgctcacggtgaagaagagcttgaagcgacactagcagctgctgat
cgcgtttttgctaagttagcaaaacgctaa

DBGET integrated database retrieval system