KEGG   Shewanella halifaxensis: Shal_1515Help
Entry
Shal_1515         CDS       T00654                                 

Definition
(GenBank) response regulator receiver modulated serine phosphatase
Organism
shl  Shewanella halifaxensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE Response_reg
Motif
Other DBs
NCBI-ProteinID: ABZ76081
UniProt: B0TN95
Position
complement(1824560..1825795)
Genome map
AA seq 411 aa AA seqDB search
MTMPLSLQHIRQYKIILVEDSDSERCLLLNLLDSMGFTAQGFSNAQGAIKHLQNEQVDMV
ITDWMMPQISGIELCKTIKSMPCSPYTILLTGNNQNAHMIEGIESGADDFIAKPFHSGVL
KVRILAGLRIIEMQQKLASHNKTLNQMLVKEQDYLNCLRQDLSLAAQLQRALLPKNSDLT
EGWRVTTEFKPAQDLAGDLFQCFNIDEQHIGFYLLDVSGHGTAASMLSFTLAHHLSSHQK
VWQSLDLALITNKLNREFDDPEQCGRFATLLIGIANTKTGAVELINAGHPSPIIVSPQGA
KFVDDSYAESQLPIGIDKQHHYQSQHFTMEKEEQLLLYSDGIYECRHSKFGSFGLTKLLK
NVSDARALPAEQLLHYLSYSTELWQEKQAQDDISLMLISTTNTLSHCGSQM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgcctttatctttacagcatatcaggcaatataaaattatcctggtagaagac
agcgatagtgaacgatgtttactattaaacctactcgactctatgggatttacggcccaa
gggttttctaacgcccaaggggccatcaaacaccttcaaaatgaacaggtcgatatggtg
atcactgattggatgatgcctcaaatcagcggcatcgagttatgtaaaacgataaaatcc
atgccttgctcaccctatactatattgcttaccggcaataaccagaatgcgcatatgatt
gaaggaatcgagtctggcgccgatgattttatcgcaaagccttttcacagtggcgtcctg
aaagtaagaattctcgcaggactgcgcatcatagagatgcaacaaaagctggccagtcac
aataaaacactcaaccagatgctagtaaaagagcaagattacctcaattgtcttagacaa
gatctctctcttgccgctcagcttcagcgtgcgctgcttccaaaaaattcagatttaaca
gaaggctggcgagtgactaccgaatttaaacccgcacaggatctcgcaggcgatctgttt
caatgcttcaacatcgacgagcagcatatcggtttttatctactggatgtcagtggtcat
ggcacagccgcatcaatgctaagttttactctagcgcatcatttatctagtcaccaaaaa
gtctggcaatctcttgatttagcgctgataactaacaagcttaaccgagagtttgacgac
cccgagcagtgcgggcgctttgcaacactacttatcgggatcgccaataccaagactgga
gcggttgagctcatcaatgcaggccacccctcgccaatcatagtcagcccccaaggagcc
aagtttgtcgatgatagctacgccgagtcccagctgcctataggcatagacaaacagcac
cattaccagagtcagcacttcaccatggagaaagaggagcagttgttgctctactctgat
ggtatttatgaatgcagacacagtaaatttggtagttttggtctaacaaagctactgaag
aacgtgagcgatgccagagcgttaccggcagaacaattgctccattacctcagctatagc
acggaactctggcaagaaaaacaagcccaagacgatatctctctgatgctaatctcaacc
acaaataccttgtcccattgtggttctcaaatgtaa

DBGET integrated database retrieval system