KEGG   Shewanella halifaxensis: Shal_1530Help
Entry
Shal_1530         CDS       T00654                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shl  Shewanella halifaxensis
Pathway
shl00040  Pentose and glucuronate interconversions
shl00052  Galactose metabolism
shl00500  Starch and sucrose metabolism
shl00520  Amino sugar and nucleotide sugar metabolism
shl01100  Metabolic pathways
shl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Shal_1530
   00052 Galactose metabolism
    Shal_1530
   00500 Starch and sucrose metabolism
    Shal_1530
   00520 Amino sugar and nucleotide sugar metabolism
    Shal_1530
Enzymes [BR:shl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Shal_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABZ76096
UniProt: B0TNB0
Position
complement(1845436..1846344)
Genome map
AA seq 302 aa AA seqDB search
MKQHKIRKAVIPVAGLGTRMLPATKAIPKEMLPVMDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSVENHFDTSFELETQLERRVKRQLLAEVQAICPDDVTIISVRQSQAKGLGHAILCA
KSIIGDSPFAVLLPDVLIDDASSDLTKENLAQMVALYNETEVGQIMVEGVPHELVNQYGI
ADINGKDLQPGESLPLSQLVEKPSIEDAPSNLAVVGRYILPAEIWTYLAKTPAGAGDEIQ
LTDAIAMLMENQTVNAYYMQGKSHDCGNKLGYMQAHVEHALRHKEIGTEFAEYLKAIVKT
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataaaattcgcaaggcagtgatcccagtagcaggcttaggcacgcgtatg
cttccagccactaaagctatccctaaagagatgctgcccgttatggacaagccgctgatc
caatatgttgtcagcgaggctattgctgctggcattaaagaaattgtcttagtgacccat
gccagtaagaactctgttgaaaatcacttcgataccagctttgaattagagacccaactt
gagcgtcgcgtaaaacgtcagctcttagcagaagtacaagctatctgccctgacgacgtc
actattattagtgtacgtcagtcacaagcaaagggcttaggtcatgcgattttatgtgct
aaaagcatcataggtgactcaccatttgccgtacttttacctgacgtactaattgatgac
gctagcagtgacctaactaaagaaaaccttgcccagatggtcgcactgtacaatgaaact
gaagtcggtcaaatcatggtagaaggcgtgccccatgagctcgttaaccaatacggtatt
gccgatatcaacggtaaagatttgcagccaggtgagtcgctaccgctatctcaactggtc
gagaagcctagcatcgaagatgcaccgtctaacctagccgttgtcggccgttatatatta
cctgccgaaatctggacttacttagctaagactcctgctggggctggtgatgaaattcag
cttaccgacgctatcgcaatgttgatggaaaaccaaactgtcaacgcttactacatgcaa
ggtaaaagccatgactgtggtaataagctaggctatatgcaagctcatgtagaacacgcg
ctgcgccataaagaaattggaactgagttcgccgaatatttaaaggctatcgttaagact
cttaaataa

DBGET integrated database retrieval system