KEGG   Shewanella halifaxensis: Shal_2119
Entry
Shal_2119         CDS       T00654                                 
Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
shl  Shewanella halifaxensis
Pathway
shl00061  Fatty acid biosynthesis
shl00780  Biotin metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01212  Fatty acid metabolism
shl01240  Biosynthesis of cofactors
Module
shl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Shal_2119
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Shal_2119
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Shal_2119
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shl01004]
    Shal_2119
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Shal_2119
Lipid biosynthesis proteins [BR:shl01004]
 Fatty acid synthase
  Component type
   Shal_2119
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 RmlD_sub_bind 3HCDH_N NAD_binding_2 TrkA_N Methyltransf_23 UDPG_MGDP_dh_N Methyltransf_11 ADH_zinc_N Methyltransf_25 TPMT AlaDh_PNT_C Glyco_trans_4_4
Other DBs
NCBI-ProteinID: ABZ76678
UniProt: B0TTW0
Position
2553600..2554343
AA seq 247 aa
MKHKDKVIFVTGAGQGMGLAMVKLFAEQGAKVAAIDINEAAAKQVAEQQSAESGSEVIGI
GCDISQSSSVRDAIAEVVQRLGSVDVVINNAGIGSIDSFIDTPDENWHKVINVNLTGTFY
CCREAARVMKEQGSGCIINISSTAVMSGDGPSHYCASKAGVIGLTRSIAKELAASGIRVN
TIVPGPTNTPMMADIPEEWTQQMINAIPLGRMGEPEDIAKLASFIASEDASFITGQNLAV
NGGMAFL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaaacataaagataaagtaatttttgtcacaggtgcaggtcaaggaatgggactggca
atggtgaagttattcgccgagcaaggcgccaaagttgccgctatcgatattaatgaagct
gcagccaagcaagttgccgagcaacaaagtgcagagtctggcagtgaggttatcggcatt
ggttgcgatatttctcaatctagttcagtacgagacgcgattgccgaggtggtgcagcgc
ttggggagtgttgatgttgtgattaataacgccggcattggttcaattgattcatttatc
gatacccccgatgaaaattggcacaaggtcattaatgtaaaccttaccggcacattctat
tgttgccgtgaagctgcccgtgtcatgaaagagcaggggagcggttgtatcattaatatt
tcaagtacagcggtgatgtcaggtgatggccctagtcattattgtgcatctaaagcaggg
gtgattggacttacccgctcaatagcaaaagaacttgctgcaagtggcattcgcgtcaac
accatcgttccaggtccaaccaatacgccaatgatggcagatattccagaagagtggact
cagcagatgatcaacgctattccattaggccgtatgggagaacccgaggatatcgcaaag
cttgcgtcttttattgccagtgaagatgcctctttcattaccgggcaaaatttggcagtt
aatggcggcatggcatttttgtaa

DBGET integrated database retrieval system