KEGG   Shewanella halifaxensis: Shal_2132Help
Entry
Shal_2132         CDS       T00654                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shl  Shewanella halifaxensis
Pathway
shl00071  Fatty acid degradation
shl00072  Synthesis and degradation of ketone bodies
shl00280  Valine, leucine and isoleucine degradation
shl00310  Lysine degradation
shl00362  Benzoate degradation
shl00380  Tryptophan metabolism
shl00620  Pyruvate metabolism
shl00630  Glyoxylate and dicarboxylate metabolism
shl00640  Propanoate metabolism
shl00650  Butanoate metabolism
shl00900  Terpenoid backbone biosynthesis
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
shl01212  Fatty acid metabolism
shl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shal_2132
   00630 Glyoxylate and dicarboxylate metabolism
    Shal_2132
   00640 Propanoate metabolism
    Shal_2132
   00650 Butanoate metabolism
    Shal_2132
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shal_2132
   00072 Synthesis and degradation of ketone bodies
    Shal_2132
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shal_2132
   00310 Lysine degradation
    Shal_2132
   00380 Tryptophan metabolism
    Shal_2132
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shal_2132
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shal_2132
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shal_2132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shl04147]
    Shal_2132
Enzymes [BR:shl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shal_2132
Exosome [BR:shl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shal_2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: ABZ76691
UniProt: B0TTX3
Position
2567116..2568270
Genome map
AA seq 384 aa AA seqDB search
MPNAYIVDALRTPTGRRKGGLSHIHAIDLAAHSLKALVERNAIPAADYDDVIFGCVDTIG
SQAGNIARTSWLAAGLPLNVPGTTVDRQCGSSQQAIHFAAQAVMSGTQDVIAVGGVQTMT
QIPISSAMLAGQPLGFSTPFAESELWHKRFGDAPVDQFYAAQRIADKWQLSRDMMESFSL
ESHNRALAAIKEGYFDREIVPLAGVTQDETPRVSSLEKMASLEPVGDAYPSITAAVSSQT
CDASAAMLIVSEEALAKYQLKPRARIHHLSVLGDDPIWHLTAPIAATKAALQKAGMTLDD
IDLVEINEAFASVAMAWLKETGYSHDKTNVNGGAIALGHPLGATGVRLMTGLLHELERRG
GRFGLQTMCEGGGLANVTIIERLS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatgcatatattgttgatgcacttcgaacgccaacagggcgtcgtaaaggaggc
ttgtctcatatacacgccattgatttagcggctcactcattaaaggcattagtagaacgt
aatgctattcctgcagcagattatgacgacgttatttttggttgtgtcgatactatcggt
tcacaagctggcaatattgcacgtacttcatggctagctgcagggttaccgctgaatgta
cccggcaccacggtagaccgccaatgcggctcgtcacaacaagcaatacattttgcagcc
caagcagtgatgagcggcacccaagatgtgattgctgtggggggcgtgcagacgatgaca
caaataccgatatcttctgcaatgttagctggccaacctctgggatttagcacgccattt
gcagaaagtgagctgtggcataaacgctttggtgatgcacctgtcgatcagttttatgcg
gcgcagcgtatcgcagataaatggcaacttagtcgagacatgatggagtcattttcacta
gagagccataaccgcgcattagccgcgattaaagaaggctactttgaccgagagattgtg
ccattagccggggtcactcaagatgaaaccccaagggtatcaagccttgagaaaatggcg
tctcttgaacctgtaggcgatgcgtatccgtcaattacagcagcagtgtcgagtcaaacc
tgtgatgcttcggcagccatgttaattgtctctgaagaggcgttggctaagtatcaactt
aaacctcgtgctcgcattcatcatctaagtgtacttggtgatgatcctatctggcattta
actgcacctattgctgcaacgaaagcggcattacaaaaagctggcatgactctagatgat
attgatttagttgaaatcaatgaagcttttgcatcggttgcgatggcttggcttaaagaa
acaggttacagccatgataaaaccaatgttaatggtggtgcaattgcacttgggcatcct
ttaggcgcgacaggagttcgcttaatgacaggtttgttacacgagctagagcggcgcggt
gggcgctttgggttacaaacaatgtgtgagggcggtggccttgccaatgtcaccattatt
gagcgtttgtcataa

DBGET integrated database retrieval system