KEGG   Shewanella halifaxensis: Shal_2435Help
Entry
Shal_2435         CDS       T00654                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
shl  Shewanella halifaxensis
Pathway
shl00010  Glycolysis / Gluconeogenesis
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shal_2435
Enzymes [BR:shl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Shal_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ABZ76993
UniProt: B0TJJ7
Position
2940876..2941721
Genome map
AA seq 281 aa AA seqDB search
MGSVTTNKHANGLEYVEVNTDLCKARIFMQGAQIDYFEPVGKKPLLWVSSADDYQPGSGI
RGGIPVCWPWFGMNDNPDFPQHGFARTRVWSLESVKMREQQVDLKFTLKLSDEDRQYWPH
DTEVELLFTLSDTLSVSLKNTNHGDYDVSLTQALHTYFPISNIHQLKATGFSGAKYIEFG
KGPHPQEDDSVSFTRETDRVYTDLSECQALHTPDGIIEVRRENSKSAVLWNPWVEKSERL
SRFNSDDYLTMVCLEAANVLEDKITLAPNESHTLTTHIGWK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgtcaccacgaacaaacatgctaacggcttagagtatgtcgaagtgaacacc
gatttgtgcaaagccagaatttttatgcaaggcgcacaaattgattacttcgaacccgtc
ggtaaaaaaccactattatgggtctccagcgccgatgattatcagcccggcagcgggatc
cgtggtggtattccagtgtgctggccttggtttggaatgaatgataaccctgatttccct
caacacggcttcgcacgcacacgagtttggtctctcgagtcagtaaagatgcgcgagcaa
caggtggatctcaagttcacgcttaaactgagtgatgaagacaggcaatattggccccat
gataccgaagtagaattgctatttaccttaagtgacacactctctgtaagccttaagaat
actaaccatggtgattatgatgtcagcttaactcaggcgctgcatacctatttccccatc
agcaacattcaccaactaaaggcgacggggtttagcggggctaaatatattgaatttggt
aaaggcccccaccctcaagaagatgatagcgtcagctttacccgtgaaacggatcgtgtc
tataccgacttaagcgaatgccaagcgctgcatacgccagatggcatcatcgaagtgcgc
cgagaaaacagcaaaagtgctgtgctttggaacccatgggttgagaaatctgaacgctta
tcgcgctttaatagcgatgactatctcactatggtctgcttggaagcggccaatgtatta
gaagataagatcaccttggcacctaacgagagtcacacactcacgacccatattggctgg
aaataa

DBGET integrated database retrieval system