KEGG   Shewanella halifaxensis: Shal_3151Help
Entry
Shal_3151         CDS       T00654                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shl  Shewanella halifaxensis
Pathway
shl00010  Glycolysis / Gluconeogenesis
shl00051  Fructose and mannose metabolism
shl00562  Inositol phosphate metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
shl01130  Biosynthesis of antibiotics
shl01200  Carbon metabolism
shl01230  Biosynthesis of amino acids
Module
shl_M00002  Glycolysis, core module involving three-carbon compounds
shl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shal_3151
   00051 Fructose and mannose metabolism
    Shal_3151
   00562 Inositol phosphate metabolism
    Shal_3151
Enzymes [BR:shl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shal_3151
Exosome [BR:shl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shal_3151
  Exosomal proteins of bladder cancer cells
   Shal_3151
  Exosomal proteins of melanoma cells
   Shal_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABZ77698
UniProt: B0TQA6
Position
complement(3846944..3847726)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFATKLQDDSAEVVLCPPSIYLESVRQLLDENKE
ALNGCLVRMGAQNLSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSVIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNATEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcccatggttgctggtaattggaaaatgaatggcagtgcgcaactt
gcgcaagagcttttcaaaaaattcgctaccaagctccaagatgattcagcggaagtggta
ttgtgtccaccttctatttacttagagagtgtacgacagctactggatgaaaataaagaa
gccttaaatggttgcttagtcagaatgggcgcgcaaaacctaagtcaacatgactttggt
gcttatactggtgaaatatctggtcagatgttaaaagattccggatgtcgatatgttatt
atcgggcattcagagcgtcgccgtatgtacggagagacgagtgttatcgtggcagagaaa
tttgctgcagctcagaaacatggtttgaccccaatattatgtgttggtgagtcgggtcca
gctcgtgaagcaagacgcacttttgaagtgattgccgaagagttagatgtggtcattgaa
aaaaatggtaccatggcttttgacaacgcaattatcgcctacgagccattatgggcagta
gggacaggtaagagcgctacgccagagcaggcacaggaagttcatgcgtttattcgcaaa
cgcctctctgaagtatctccatttatcggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaatgcagcagacttgtttgctcaacctgatgtagacggtggattgatt
ggcggtgtaagcctcaatgctaccgaatttctcagtttatgtacgatagcgatgagcgca
taa

DBGET integrated database retrieval system